KEGG   Burkholderia mallei 2002734299: BM45_3476Help
Entry
BM45_3476         CDS       T03872                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
bmab  Burkholderia mallei 2002734299
Pathway
bmab00040  Pentose and glucuronate interconversions
bmab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BM45_3476
Enzymes [BR:bmab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     BM45_3476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Sacchrp_dh_NADP Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AJX05449
UniProt: A0A3N4FKQ9
LinkDB All DBs
Position
2:452818..453852
Genome map
AA seq 344 aa AA seqDB search
MKALVLEKARELALRDIDLPLEVGPADVKIRVHTVGVCGSDVHYYMHGGIGPFRVDAPMV
LGHEASGTVVEVGRDVTYLRVGERVCMEPGVPRFDSKATLHGLYNLDPSVRFWATPPVHG
CLAPYVVHPAAFTYRLPPNVSFAEGAIVEPLAIGLQAAKKAAMKPGDIAVVVGAGTIGAM
TALAALAGGAARVILADVVKEKLALFAANRAVTTVDASTQSLADAVAHATDGWGADVVFE
ASGNANAYAGIVDLLCPNGCLVLVGMPLAPVPLDVVSLQAKEARIESVFRYANVFPRALA
LIASGAIDVKPFISRTFPFSDGLRAFEAAASGQPHDVKIQIEMD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagccctcgtactcgaaaaggcgcgcgagctcgcgctgcgcgacatcgatctgccg
ctcgaggtcggccccgccgacgtcaagatccgcgtccacacggtgggcgtgtgcggcagc
gatgtccattactacatgcacggcggaatcggcccgttccgggtggacgcgccgatggtg
ctcggccacgaggcgtcgggcacggtcgtcgaggtcgggcgcgacgtcacgtacctgcgc
gtgggcgagcgcgtgtgcatggagcccggcgtgccgcgcttcgattcgaaagcgacgctg
cacggcctgtacaacctcgatccgtcggtgcgcttctgggcgacgccgcccgtgcacggg
tgcctcgcgccctacgtcgtgcacccggcggcgttcacgtaccggctgccgccgaacgtg
tcgttcgccgagggcgcgatcgtcgagccgctcgcgatcgggctgcaggccgcgaagaag
gcggcgatgaagccgggcgacatcgcggtggtcgtcggcgcgggcacgatcggcgcgatg
acggcgctcgccgcgctcgcgggcggcgccgcgcgcgtgatcctcgccgacgtcgtcaag
gaaaagctcgcgctgttcgccgcgaaccgcgcggtgacgacggtcgacgcgagcacgcag
tcgctcgccgacgcggtcgcgcacgcgaccgacggctggggcgcggacgtggtgttcgag
gcgagcggcaacgcgaacgcgtatgcgggcatcgtcgatctgctgtgcccgaacggctgc
ctcgtgctggtcggcatgccgctcgcgccggtgccgcttgatgtcgtttcgctgcaggcg
aaggaggcgcgcatcgaatcggtgttccgctacgcgaacgtcttcccgcgcgcgctcgcg
ctgatcgcctccggcgcgatcgacgtgaagccgttcatctcgcgcacgttcccgttctcg
gacggcctgcgcgcattcgaggcggcggcgagcggccagccgcacgacgtgaagattcag
atcgaaatggattga

DBGET integrated database retrieval system