KEGG   Burkholderia mallei 2002734299: BM45_485Help
Entry
BM45_485          CDS       T03872                                 

Gene name
mrdB
Definition
(GenBank) rod shape-determining protein RodA
  KO
K05837  rod shape determining protein RodA
Organism
bmab  Burkholderia mallei 2002734299
Brite
KEGG Orthology (KO) [BR:bmab00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bmab03036]
    BM45_485 (mrdB)
Chromosome and associated proteins [BR:bmab03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BM45_485 (mrdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTSW_RODA_SPOVE QCR10
Motif
Other DBs
NCBI-ProteinID: AJX02048
UniProt: A0A3N4FLG5
LinkDB All DBs
Position
1:complement(498996..500144)
Genome map
AA seq 382 aa AA seqDB search
MQFDKRASLDKIKQMFAGFDRPLALIVFLLLCVGIVTLYSASVDVPGRVEDQLRNIMLTF
VLMWVIANIPPQTLMRFAVPLYSFGVALLVAVALFGMTKKGAKRWLNVGVVIQPSEILKI
ATPLMLAWYYQRRESSLRWYDFVVAFAILMVPVGLIAKQPDLGTAVLVFAAGLFVIYLAG
LSFKLIVPVLVAGVLAVGSIAVFEERICQPEVVWPLMHDYQKHRVCTLLDPTSDPLGKGF
HTIQAVIAIGSGGPLGKGYLKGTQAHLEFIPEKHTDFIFAVFSEEFGLVGGLVLLTLYMA
LIARGLYIAAQGATLFGRLLAGSLTLAFFVYAFVNIGMVSGVLPVVGVPLPFMSYGGTAL
TTLGIAVGLIMSVGRQKRLMKS
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcgacaagcgcgcctcgctcgacaagatcaagcagatgttcgcgggcttcgac
cggccgctcgcgctcatcgtgttcctgctgctgtgcgtcggcatcgtcacgctgtacagc
gcgagcgtcgacgtgccggggcgcgtcgaggaccagttgcgcaacatcatgctgacgttc
gtgctgatgtgggtgatcgcgaacatcccgccgcagacgctgatgcgcttcgcggtgccg
ctctattcgttcggcgtcgcgctgctcgtcgcggtggcgctattcggcatgacgaagaag
ggcgcgaagcgctggctgaacgtcggcgtcgtgatccagccgtccgagatcctcaagatc
gcgacgccgctgatgctcgcgtggtactaccagcggcgcgaaagcagcctgcgctggtac
gacttcgtcgtcgcgttcgccatcctgatggtgcccgtcgggctgatcgcgaaacagccg
gatctcggcaccgccgtgctcgtgttcgccgcgggcctgttcgtgatctatctcgcgggg
ctgtcgttcaagctgatcgtgccggtgctcgtcgccggcgtgctcgcggtcggctcgatc
gccgtgttcgaggagcgcatctgccagcccgaagtcgtctggccgctgatgcacgattat
cagaaacaccgcgtctgcacgctgctcgatccgacgtccgacccgctcggcaaaggcttc
cacacgatccaggcggtgatcgcgatcggctcgggcggcccgctcggcaaggggtatctg
aagggcacgcaggcgcacctcgaattcattccggaaaagcacaccgatttcatcttcgcg
gtgttttccgaggaattcgggctcgtcggcgggctcgtgctgctgacgctgtacatggcg
ctgatcgcgcgcgggctctacatcgccgcgcagggcgcgacgctgttcgggcggctgctc
gccggctcgctcacgctcgcgttcttcgtctacgcgttcgtcaatatcggaatggtgagc
ggcgtgctgcccgtcgtcggcgtgccgctgccgttcatgagctacggcggcacggcgctc
acgacgctcggcatcgccgtcgggctcatcatgagcgtcgggcggcagaagcggctgatg
aagagttga

DBGET integrated database retrieval system