KEGG   Burkholderia mallei 2002734299: BM45_486Help
Entry
BM45_486          CDS       T03872                                 

Gene name
mrdA
Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
bmab  Burkholderia mallei 2002734299
Pathway
bmab00550  Peptidoglycan biosynthesis
bmab01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bmab00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BM45_486 (mrdA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BM45_486 (mrdA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmab01011]
    BM45_486 (mrdA)
Enzymes [BR:bmab01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BM45_486 (mrdA)
Peptidoglycan biosynthesis and degradation proteins [BR:bmab01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BM45_486 (mrdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AJX02397
UniProt: A0A3N4FZ63
LinkDB All DBs
Position
1:complement(500156..502564)
Genome map
AA seq 802 aa AA seqDB search
MTEFKDTQQQLSKFRLRVAAAGVFVFVCFGLLATRFFYLQVWQHGKYALQAEENRISVAP
IVPNRGIITDRNGVVLAKNYSAYTLEITPSKLADTLDNTINALAEVVQIDARDRRRFKKL
QEDSKNFESLPIRTRLTDDEVARFTAQRWRFPGVDVRARLFRQYPLGPTAAHVIGYIGRI
SKRDQDRIDAMSDENDSDPETYDPRRDANNYKGTDYIGKVGVEQSYETELHGITGFEEVE
VTAGGRPVRTLSRTQATPGSNLVLSLDIGLQQVAEQAFAGKRGALVAIEPKTGDVLAFVS
SPSFDPNSFVDGIDQQTWDELNNSPDKPLLNRPLHGTYPPGSTYKPFMALAGLALGKRTP
GWGFQDPGYFTFGGHTFRNDVRSGQGWVDMNKAIMVSNDTYFYMLARDLGVTAIANFMKP
FGFGQLTGIDIQGEARGILPSPEWKKTFKKAAQQKWFDGETISLGIGQGYNSFTILQLAH
ATATLANDGVIMKPHLVKEVENPISRARHLTVPKESGVIPLKQNDLDVVKRGMENVVESP
SGTAFKVFRGAPYLAAGKTGTAQVFSLQGGNYRGHLLAEHLRDHALFIAYAPVDHPQIAL
ALIVENGGWGAQSAGPIARRVLDFYLLERKNPSTEAAAVAAAASATEPVNAPVIGDATKP
VGIAAGFKALPQPVPPASASGADGASGASGAGGEPTEHANAGGNPAGGGIAGGAAGTANN
GSGAAAPGGMPGANGAAMGAPPASRRLPPRKPRRTPASDAAISAAASRDDPRKPSSGAPK
TPAQDDNHAVSAARPAAGGIDE
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaattcaaggacacacaacagcagctctcgaagttccgcctgcgcgtcgcggcg
gcgggcgtgttcgtgttcgtctgcttcggcctgctcgccacgcggttcttctacctccag
gtctggcagcacggcaagtacgcgctgcaggccgaggagaaccggatctcggtcgccccg
atcgtcccgaaccgcgggatcatcaccgatcgcaacggcgtcgtgctcgcgaagaactac
tccgcgtacacgctcgagatcacaccgtcgaagctcgccgacacactcgacaacacgatc
aacgcgctcgccgaggtcgtgcagatcgacgcgcgcgaccgccgccgcttcaagaagctg
caggaggactcgaagaatttcgagagcctgccgatccgcacgcgcctcaccgacgacgaa
gtcgcgcgctttaccgcgcagcgctggcgctttccgggcgtcgacgtgcgcgcgcgcctg
ttccgccaatatccgctcggtccgacggccgcgcatgtgatcggctacatcggccggatc
tcgaagcgcgatcaggaccggatcgacgcgatgagcgacgagaacgacagcgatccggaa
acctacgacccgcggcgcgacgcgaacaactacaagggcaccgactacatcggcaaggtc
ggcgtcgagcaaagctacgaaaccgagctgcacggcatcaccggcttcgaggaagtcgag
gtgacggcgggcgggcggcccgtgcgcacgctgtcgcgcacgcaggcgacgcccggcagc
aacctcgtgctgtcgctcgacatcgggttgcagcaggttgccgagcaggcattcgccggc
aaacgcggcgcgctcgtcgcgatcgagccgaagacgggcgacgtgctcgcgttcgtgtcg
tcgccgagcttcgacccgaactcgttcgtcgacggcatcgaccagcagacctgggacgag
ctcaacaactcgcccgacaagccgctgctgaaccggccgctgcacggcacctatccgccc
ggctcgacgtacaagccgttcatggcgctcgccggcctcgcgctcggcaagcgcacgccg
ggctggggcttccaggaccccggctacttcacgttcggcggccacacgttccgcaacgac
gtgcgctcgggccagggctgggtcgacatgaacaaggcgatcatggtgtcgaacgacacg
tacttctacatgctcgcgcgcgaccttggcgtgaccgcgatcgcgaacttcatgaagccg
ttcggcttcggccagctgacgggcatcgacatccagggcgaggcgcgcgggatcctgccg
tcgcccgaatggaagaagacgttcaagaaggccgctcagcagaaatggttcgacggcgag
acgatcagtctcgggatcggccagggctacaactcgttcacgatcctgcagctcgcgcac
gcgacggccacgctcgcgaacgacggcgtgatcatgaagccgcacctcgtgaaggaagtc
gagaacccgatctcgcgcgcgcggcacctgacggtgccgaaggaaagcggcgtgattccg
ctcaagcagaacgatctcgacgtcgtgaagcgcgggatggagaacgtcgtcgaaagcccg
tccggcaccgcgttcaaggtgttccgcggcgcgccgtacctcgcggccggcaagaccggc
accgcgcaggtgttctcgctgcagggcggcaactaccgcggccacctgctcgccgagcat
ctgcgcgaccacgcgctgttcatcgcgtacgcgcccgtcgaccatccgcagatcgcactt
gcgctgatcgtcgagaacggtggctggggcgcgcagtcggcgggcccgatcgcgcggcgc
gtgctcgatttctacctgctcgagcgcaagaatccgtcgacggaagcggcggccgtcgcg
gcggccgcgtcggcgaccgagcccgtgaacgcgcccgtgatcggcgacgcgacgaagcct
gtcggcatcgcggccgggttcaaggcgctgccgcaaccggtgccgcccgcgtcggcaagc
ggcgcggacggcgcatcaggcgcatcgggcgcgggcggggagccgacggagcacgcaaac
gcgggaggaaacccggccggcggcggcattgcaggcggcgcggccggcacggcgaacaac
ggatcgggcgccgcggccccgggcggcatgcccggcgcgaacggcgcggcaatgggcgcg
ccgcccgcatcccgccgcctgccgccgcgcaagccgcgccgcacgccggcgagcgacgcg
gcgatcagcgccgccgcatcgcgggacgacccgcgcaaaccctcatcgggcgccccgaag
acacccgctcaggacgacaaccatgccgtctccgccgccaggccggcggcgggcggcatc
gacgagtaa

DBGET integrated database retrieval system