KEGG   Burkholderia mallei 6: DM78_39Help
Entry
DM78_39           CDS       T03489                                 

Gene name
acoD
Definition
(GenBank) acetaldehyde dehydrogenase 2
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bmae  Burkholderia mallei 6
Pathway
bmae00010  Glycolysis / Gluconeogenesis
bmae00620  Pyruvate metabolism
bmae01100  Metabolic pathways
bmae01110  Biosynthesis of secondary metabolites
bmae01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DM78_39 (acoD)
   00620 Pyruvate metabolism
    DM78_39 (acoD)
Enzymes [BR:bmae01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     DM78_39 (acoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIO57489
UniProt: A0A381BI84
LinkDB All DBs
Position
1:46597..48117
Genome map
AA seq 506 aa AA seqDB search
MNHADMQHLNIEFPYRKQYGNFIGGEWVAPVGGEYFDNVSPVTGRPFTAIPRSREADIEL
ALDAAHAAKAGWAAKGAAERANVLLRIADRMEANLTRLAVAETIDNGKPLRETTAADVPL
AIDHFRYFAGCIRAQEGSIADIGGDMVAYHFHEPLGVVGQIIPWNFPLLMAAWKLAPALA
AGNCVVLKPAEQTPASILVFAELIQDLLPPGVLNIVNGFGLEAGKPLASSKRIAKIAFTG
ETSTGRLIMQYASENLIPVTLELGGKSPNIFFADVMDRDDSYFDKALEGFAMFALNQGEV
CTCPSRALVEESIYDRFIERALKRVEAIKQGHPLDSQTMIGAQASAEQLEKILSYIDIGR
GEGAQCLTGGERNVLGGELAEGYYVKPTVFRGHNKMRIFQEEIFGPVLAVTTFKTEEEAL
EIANDTLYGLGAGVWTRDGNRAYRFGRGIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRET
HKMMLDHYQQTKNLLVSYSEKPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgcggacatgcaacatctgaacatcgaattcccgtaccgcaagcagtacggg
aatttcatcggcggcgaatgggtcgccccggtcggcggcgagtatttcgacaacgtctcg
cccgtcaccggccggccgttcaccgcgatccctcgctcgcgcgaagccgacatcgagctc
gcgctcgacgccgctcacgcggccaaggcgggctgggccgcgaagggcgcggccgagcgc
gcgaacgtgctgctgaggatcgccgaccggatggaggcgaacctcacgcgcctcgccgtc
gccgagacgatcgacaacggcaagccgctgcgcgaaaccaccgcagccgacgtgccgctc
gcgatcgaccacttccgctacttcgcgggctgcatccgcgcgcaggaaggctcgatcgcc
gatatcggcggcgacatggtggcctaccacttccacgagccgctcggcgtcgtcggccag
atcatcccgtggaacttcccgctgctgatggccgcgtggaagctcgcgccggcgctcgcg
gccggcaactgcgtcgtgctcaagccggccgagcagacgcccgcgtcgatcctcgtgttc
gccgagctgatccaggatctgctgccgcccggcgtgctcaacatcgtcaacggcttcggc
ctcgaggccggcaagccgctcgcgtcgagcaagcggatcgcgaagatcgcgttcacgggc
gagacgtcgacgggccgcctcatcatgcagtacgcgagcgagaacctgattcccgtcacg
ctcgagctgggcggcaagagcccgaatattttcttcgccgacgtgatggatcgcgacgac
agctacttcgacaaggcgctcgaaggcttcgcgatgttcgcgctgaaccagggcgaagtc
tgcacgtgcccatcgcgcgcgctcgtcgaggagagcatctacgatcgcttcatcgaacgc
gcgctcaagcgcgtcgaggcgatcaagcagggccatccgctcgattcgcagacgatgatc
ggcgcgcaggcgtcggccgagcagctcgagaagatcctgtcgtacatcgacatcggccgc
ggcgaaggcgcgcaatgcctgacgggcggcgagcgcaacgtgctcggcggcgagctcgcc
gaaggctattacgtgaagccgaccgtgttccgcggccacaacaagatgcgcatcttccag
gaagaaatcttcgggccggtgctcgcggtgacgacgttcaagaccgaggaggaagcgctc
gagatcgcgaacgacacgctgtacggcctgggcgccggcgtctggacgcgcgacggcaac
cgcgcgtaccgcttcggccgcggcatccaggcgggccgcgtgtggacgaactgctatcac
gcgtatccggcgcacgcggcgttcggcggctacaagcaatccggcatcggccgcgagacg
cacaagatgatgctcgaccactaccagcagacgaagaacctgctcgtcagctacagcgaa
aagccgctcgggttcttctga

DBGET integrated database retrieval system