KEGG   Burkholderia mallei 6: DM78_4381Help
Entry
DM78_4381         CDS       T03489                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur family protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bmae  Burkholderia mallei 6
Pathway
bmae00020  Citrate cycle (TCA cycle)
bmae00190  Oxidative phosphorylation
bmae00650  Butanoate metabolism
bmae01100  Metabolic pathways
bmae01110  Biosynthesis of secondary metabolites
bmae01120  Microbial metabolism in diverse environments
bmae01130  Biosynthesis of antibiotics
bmae01200  Carbon metabolism
Module
bmae_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmae_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bmae_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bmae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DM78_4381
   00650 Butanoate metabolism
    DM78_4381
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DM78_4381
Enzymes [BR:bmae01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DM78_4381
    1.3.5.4  fumarate reductase (quinol)
     DM78_4381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4_4
Motif
Other DBs
NCBI-ProteinID: AIO55529
LinkDB All DBs
Position
2:complement(1488012..1488719)
Genome map
AA seq 235 aa AA seqDB search
MADTRILDIYRYDPDDGRAPRMQRYELAPRAEDRMLLDVLGRVKAQDETLSYRRSCREGV
CGSDAMNINGRNGLACVTSMQALPREIVLRPLPGLPVVRDLIVDMTSFFNQYHSVRPYLV
NEGVPPERERLQTPQEREQLDGLYECILCACCSSACPSYWWNPDKFVGPAGLLQAYRFIV
DSRDDASAARLDDLEDPYRLFRCRTIMNCVDVCPKGLNPARAIGQIRTMLARRAV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggccgatacccgcattctcgacatctaccgctacgatccggacgacgggcgcgcgccg
cgcatgcagcgctatgagctcgcgccgcgcgcggaagaccggatgctgctcgacgtgctc
ggccgcgtgaaggcgcaggacgagacgctgtcgtatcgccgctcgtgccgcgagggcgtg
tgcggctccgacgcgatgaacatcaacggccgcaacgggctcgcctgcgtgacgagcatg
caggcgctgccgcgcgaaatcgtgctgcggccgctgccggggctgcccgtcgtgcgcgat
ctgatcgtcgacatgacgagcttcttcaatcagtaccattcggtccgcccgtatctcgtc
aacgaaggcgtgccgcccgaacgagagcgcctgcagacgccgcaagagcgcgagcagctc
gacggcctctacgaatgcatcctgtgcgcgtgctgctcgagcgcgtgcccgagctactgg
tggaatcccgacaagttcgtcgggccggcggggctgctgcaggcgtaccgcttcatcgtc
gattcgcgcgacgacgcgagcgccgcgcgcctcgacgatctcgaggacccgtaccggctg
ttccgctgccggaccatcatgaactgtgtcgatgtctgtccgaaaggcctgaacccggcg
cgcgcgatcggacagatccgcacgatgctcgcgcggcgcgcggtatag

DBGET integrated database retrieval system