KEGG   Burkholderia mallei 6: DM78_860Help
Entry
DM78_860          CDS       T03489                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bmae  Burkholderia mallei 6
Pathway
bmae00020  Citrate cycle (TCA cycle)
bmae00480  Glutathione metabolism
bmae01100  Metabolic pathways
bmae01110  Biosynthesis of secondary metabolites
bmae01120  Microbial metabolism in diverse environments
bmae01130  Biosynthesis of antibiotics
bmae01200  Carbon metabolism
bmae01210  2-Oxocarboxylic acid metabolism
bmae01230  Biosynthesis of amino acids
Module
bmae_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmae_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bmae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DM78_860 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DM78_860 (icd)
Enzymes [BR:bmae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     DM78_860 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIO59684
UniProt: A0A381BBK9
LinkDB All DBs
Position
1:complement(943592..944851)
Genome map
AA seq 419 aa AA seqDB search
MPYQHIKVPEGGDKITVNKDFSLNVSDQPIIPYIEGDGTGFDITPVMIKVVDAAVEKAYG
GKKKIHWMEIYAGEKATKVYGPDVWLPEETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPIQYFKGVPSPVREPEKTNMVIFRENSEDIYAGIEWAAESEQAKKVIKF
LQEEMGVKKIRFPQTSGIGIKPVSKEGTERLVRKAIQYAIDNDRKSVTLVHKGNIMKFTE
GAFRDAGYALAQKEFGAELIDGGPWMKFKNPKTGNEIVVKDSIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADVIISAMEKSIKQKRVTYDFARLMEGATQVSCSGFGQVLIENME
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccggaaggcggtgacaagatcaccgtcaacaaggat
ttctcgctcaacgtttccgatcagccgatcatcccttacatcgagggcgacggcacgggc
ttcgacatcacgccggtgatgatcaaggtcgtcgacgcggcggtcgagaaggcgtacggc
ggcaagaagaagattcactggatggagatctacgccggcgagaaggcgacgaaggtctac
ggcccggacgtgtggctgccggaagagacgctgcaggtgctgaaggaatacgtcgtgtcg
atcaaggggccgctcacgaccccggtcggcggcggcatccgctcgctgaacgtcgcgctg
cgtcaggagctcgacctgtacgtctgcctgcgcccgatccagtacttcaagggcgtgcct
tcgcccgtgcgcgagccggagaaaaccaacatggtcatcttccgcgagaactcggaagac
atctacgccggcatcgaatgggcggccgaatccgagcaggcgaagaaggtcatcaagttc
ctgcaggaagagatgggcgtgaagaagatccgcttcccgcagacctcgggcatcggcatc
aagcccgtgtcgaaggaaggcaccgagcgcctcgtgcgcaaggcgatccagtacgcgatc
gacaacgaccgcaagtcggtcacgctcgtccacaagggcaacatcatgaagttcacggaa
ggtgcgttccgtgacgccggctatgcgctcgcgcagaaggaattcggcgccgagctgatc
gacggcggcccgtggatgaagttcaagaacccgaagacgggcaacgagatcgtggtcaag
gattcgatcgccgacgcgttcctgcagcagatcctgctgcgcccggccgaatacgacgtg
atcgcgacgctgaacctgaacggcgactacatctcggacgcgctcgccgcgcaagtcggc
ggcatcggcatcgcgccgggcgcgaacctgtcggattcggtcgcgatgttcgaagcgacg
cacggcacggcgccgaagtacgcgggcaaggattacgtgaacccgggttcggaaatcctg
tcggccgaaatgatgctgcgccacctcggctggaccgaagcggccgacgtgatcatttcc
gcgatggagaagtcgatcaagcagaagcgcgtcacgtacgacttcgcgcgcctgatggaa
ggcgcgacgcaagtgtcgtgctcgggcttcggtcaggtgctgatcgaaaacatggagtaa

DBGET integrated database retrieval system