KEGG   Burkholderia mallei 6: DM78_869Help
Entry
DM78_869          CDS       T03489                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase Fe
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bmae  Burkholderia mallei 6
Brite
Enzymes [BR:bmae01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DM78_869 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIO58174
UniProt: A0A381BJL4
LinkDB All DBs
Position
1:complement(950732..951310)
Genome map
AA seq 192 aa AA seqDB search
MAHTLPPLPYAEDALAPHISQETIQFHYGKHHQAYVTNLNNLIPGTEFENLPLEEIVKKS
SGGIFNNAAQIWNHTFFWNSLSPNGGGAPTGALGDAINAKWGSFDAFKEAFTKAAVGTFG
SGWAWLVKKADGSLDIVSTSNAATPLTTADKPLVTIDVWEHAYYIDYRNARPKFVEAFWN
IVNWDFAAKNFA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggctcatacgctcccgccgctgccgtacgctgaagacgccctcgctccgcatatctcg
caggagacgatccagtttcactacggcaagcatcaccaggcttatgtgacgaacctgaac
aacctgatccccggcaccgagttcgagaacctgccgctggaagagatcgtgaagaagtcg
tcgggcggcatcttcaacaacgccgcgcagatctggaatcacacgttcttctggaacagc
ctgtcgccgaacggcggcggcgcgccgacgggcgcgctcggcgacgcgatcaacgcgaag
tggggttcgttcgacgcgttcaaggaggcgttcacgaaggcagcggtcggcacgttcggc
tcgggctgggcttggctcgtgaagaaggcggacggctcgctcgacatcgtgtcgacgagc
aatgcggccacgccgctcacgacggccgacaagccgctcgtcacgatcgacgtgtgggaa
cacgcttactacatcgattaccgcaacgcgcgcccgaagttcgtcgaagcgttctggaac
atcgtgaactgggacttcgccgcgaagaacttcgcgtaa

DBGET integrated database retrieval system