KEGG   Burkholderia mallei FMH 23344: DM51_1025Help
Entry
DM51_1025         CDS       T03523                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bmaf  Burkholderia mallei FMH 23344
Pathway
bmaf00010  Glycolysis / Gluconeogenesis
bmaf00053  Ascorbate and aldarate metabolism
bmaf00071  Fatty acid degradation
bmaf00280  Valine, leucine and isoleucine degradation
bmaf00310  Lysine degradation
bmaf00330  Arginine and proline metabolism
bmaf00340  Histidine metabolism
bmaf00380  Tryptophan metabolism
bmaf00410  beta-Alanine metabolism
bmaf00561  Glycerolipid metabolism
bmaf00620  Pyruvate metabolism
bmaf00625  Chloroalkane and chloroalkene degradation
bmaf00903  Limonene and pinene degradation
bmaf01100  Metabolic pathways
bmaf01110  Biosynthesis of secondary metabolites
bmaf01120  Microbial metabolism in diverse environments
bmaf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bmaf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DM51_1025
   00053 Ascorbate and aldarate metabolism
    DM51_1025
   00620 Pyruvate metabolism
    DM51_1025
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DM51_1025
   00561 Glycerolipid metabolism
    DM51_1025
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DM51_1025
   00310 Lysine degradation
    DM51_1025
   00330 Arginine and proline metabolism
    DM51_1025
   00340 Histidine metabolism
    DM51_1025
   00380 Tryptophan metabolism
    DM51_1025
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DM51_1025
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    DM51_1025
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DM51_1025
Enzymes [BR:bmaf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     DM51_1025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIP77445
UniProt: A0A381BDP2
LinkDB All DBs
Position
1:complement(1150076..1151512)
Genome map
AA seq 478 aa AA seqDB search
MKTCEQFYIGGAWRPSTGKGMIDVIDSGTEAVIGRVPEGTAEDAKAAVAAARAAFDGWAA
TPPAERARYLHKITENLKARSEELAQSITGEVGMPIKLSRAIQVGGPIYNWGAYAKLAET
FAFEEQVGNSLVVREPVGVVAAITPWNYPLNQITLKVAAALAAGCTVALKPSEVAPLNAF
ILAEAIHDAGLPAGVFNLVCGYGPVVGEALASDADVDMVSFTGSTRAGKRVAELAAAGVK
RVALELGGKSASVILDDADFAAAVKGTVSACYLNAGQTCSAHTRMLVPESRYEEARDLAK
AAAQAYVAGDPRDDATRLGALASSVQQKRVQDYIRRSIDEGAELVTGGLGMPEGITRGFF
VKPTVFGRVKPDATIAQEEIFGPVLSILTYRDEDDAVRIANDSPYGLGGAVWAGSDERAM
RVARRIRTGQVDINGGAWNMAAPFGGFKQSGIGRENGVYGLDEYLEYKSMQLRPHKRA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctgcgaacagttctacatcggcggtgcatggcgcccgagcacgggcaagggc
atgatcgacgtgatcgactccggcaccgaggccgtgatcggccgcgtccccgaaggcacc
gccgaagacgcgaaagcggccgtcgcggccgcgcgcgcggcgttcgacggctgggccgcg
acgccgcccgccgagcgcgcccgctatctgcacaagatcaccgagaacctgaaggcgcgc
agcgaggagctcgcgcaatcgatcacgggcgaagtcggcatgccgatcaagctgtcgcgc
gcgatccaggtcggcgggccgatctacaactggggcgcgtatgcgaaactcgccgagacc
ttcgcgttcgaggagcaggtgggcaattcgctcgtcgtgcgcgagcctgtcggcgtcgtc
gcggcgatcacgccctggaactatccgctcaaccagatcacgctgaaggtcgcggccgcg
ctcgcggcgggctgcacggtcgcgctgaagccgtccgaggtcgcaccgctcaatgcgttc
atcctcgccgaggcgattcacgacgcggggctgcccgccggcgtgttcaatctcgtgtgc
ggctacgggcccgtcgtcggcgaggcgctcgcgagcgacgccgatgtcgacatggtgtcg
ttcaccggctcgacgcgcgcgggcaagcgcgtcgccgagctcgccgcggccggcgtgaag
cgcgtcgcgctcgaactgggcggcaaatcggcgtcggtgattctcgacgacgccgatttc
gcggccgcggtgaagggcacggtgtccgcgtgctatctgaacgccgggcagacgtgctcc
gcgcatacgcgcatgctcgtgcccgaatcgcgctacgaggaggcgcgcgacctcgcgaag
gccgccgcgcaagcctatgtcgcgggcgatccgcgcgacgacgcgacgcggctcggcgcg
ctcgcgtcgtcggtccagcaaaagcgcgtgcaggattacatccggcgcagcatcgacgaa
ggcgcggagctcgtcacgggcggcctcggcatgccggagggcatcacgcgcggcttcttc
gtgaagccgaccgtgttcgggcgcgtgaagcccgacgcgacgatcgcgcaggaggagatc
ttcggcccggtgctgtcgattctcacgtatcgcgacgaggatgacgcggtgcgcatcgcg
aacgattcgccgtacgggctcggcggcgcggtgtgggcgggcagcgacgagcgcgcgatg
cgcgtcgcgcgccgcatccgcacggggcaggtcgatatcaacggcggggcatggaacatg
gccgcgccgttcggcggtttcaaacagtcgggcatcggccgcgagaacggcgtgtacggc
ctcgacgaatatctcgaatacaaatcgatgcaattgcgcccgcacaagcgcgcgtga

DBGET integrated database retrieval system