KEGG   Burkholderia mallei FMH 23344: DM51_2040
Entry
DM51_2040         CDS       T03523                                 

Gene name
phnG
Definition
(GenBank) phosphonate C-P lyase system protein PhnG
  KO
K06166  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnG [EC:2.7.8.37]
Organism
bmaf  Burkholderia mallei FMH 23344
Pathway
bmaf00440  Phosphonate and phosphinate metabolism
bmaf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmaf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    DM51_2040 (phnG)
Enzymes [BR:bmaf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.37  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase
     DM51_2040 (phnG)
SSDB
Motif
Pfam: PhnG TetR_C_11 Collagen
Other DBs
NCBI-ProteinID: AIP75115
UniProt: A0A3N4FPB9
LinkDB
Position
1:2298645..2299193
AA seq 182 aa
MSASAVSSLHAARRDWLAVLAKIPRDELERALDRVLDGAPAPAFDWLRAPEIGLAMVRGR
IGGTGDPFNLGEASVTRAALRLRGDRTNGTTGTTGADGMNGANGANRPHGATVGIAYVLG
RDKRRAELVALADALLQTPERHERLRAALIEPFRARLAQARAARSGEIATTRVEFFTMVR
GE
NT seq 549 nt   +upstreamnt  +downstreamnt
atgagcgcctcagccgtttcctccttgcatgccgcgcgacgcgactggctcgcggtgctg
gcgaagattccccgcgacgaactcgagcgggcgctcgatcgcgtgctcgacggcgcgccc
gcacccgcgttcgactggctgcgcgccccggagatcgggctggcgatggtgcgcgggcgc
atcggcggcacgggcgatccgttcaatctcggcgaggcgagcgtcacgcgcgccgcgctg
cgcctgcgcggcgaccgcacgaacggcacgaccggcacgaccggcgcggatgggatgaat
ggtgcgaacggtgcgaaccgcccgcacggcgcgacggtcggcatcgcttacgtgctcggc
cgcgacaagcggcgcgcggagctcgtcgcgctcgccgacgcgctattgcagacgccggag
cgccatgagcggctgcgcgccgcgctgatcgagccgtttcgcgcacgccttgcgcaagcg
cgtgcggcgcgctcgggggaaatcgcgacgacgcgcgtcgaattcttcacgatggtgcga
ggcgaatga

DBGET integrated database retrieval system