KEGG   Burkholderia mallei FMH 23344: DM51_2041
Entry
DM51_2041         CDS       T03523                                 

Gene name
phnH
Definition
(GenBank) phosphonate C-P lyase system protein PhnH
  KO
K06165  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnH [EC:2.7.8.37]
Organism
bmaf  Burkholderia mallei FMH 23344
Pathway
bmaf00440  Phosphonate and phosphinate metabolism
bmaf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmaf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    DM51_2041 (phnH)
Enzymes [BR:bmaf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.37  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase
     DM51_2041 (phnH)
SSDB
Motif
Pfam: PhnH
Other DBs
NCBI-ProteinID: AIP75542
LinkDB
Position
1:2299196..2299819
AA seq 207 aa
MIDTRFSLADVAPGFADPVQATQRVFRTLLDAMARPGTPGRIEPIGANGSDAAPAMRVAP
AAFASLLTLCDASTPVFLGAPDAALASALRFHTGAPIAAEPRAACFAYLDDANALPPLQC
FASGAPQTPEHAVTLFVRVASLADGEPRTLRGPGIRDARTIAPAGLPDAFWRERAQFAPR
FPCGIDCYLVCGDMLIGLPRTTIVEAY
NT seq 624 nt   +upstreamnt  +downstreamnt
atgatcgatacgcgtttctcgctcgccgatgtcgcgcccggcttcgcggatccggtgcaa
gccacgcagcgcgtgttccgcacgctgctcgacgcgatggcgcgccccggcacgcccggg
cgcatcgagccgatcggcgcgaacggctcggacgccgcgccggcgatgcgcgtcgcgccc
gcggcgttcgcgtcgctgctcacgctgtgcgacgcgtccacgccggtgtttctcggcgcg
ccggacgcggcgctcgcgtcggcgctgcgcttccatacgggcgcgccgatcgccgccgag
ccgcgcgccgcgtgcttcgcctacctcgacgacgcgaacgcgctgccgccgctgcagtgc
ttcgcgagcggcgcgccgcagacgcccgagcatgcggtgacgctgttcgtgcgcgtcgcg
tcgctcgcggacggcgagccgcgcacgctgcgcgggccgggcattcgcgacgcgcgcacg
atcgcgccggcgggcttgcccgatgcattctggcgcgaacgcgcgcaattcgccccgcgc
tttccgtgcggaatcgattgctacctggtgtgcggcgacatgctgatcggcctgccgcgc
acgacgatcgtggaggcatactga

DBGET integrated database retrieval system