KEGG   Burkholderia mallei FMH 23344: DM51_2042
Entry
DM51_2042         CDS       T03523                                 

Definition
(GenBank) bacterial phosphonate metabolism family protein
  KO
K06164  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnI [EC:2.7.8.37]
Organism
bmaf  Burkholderia mallei FMH 23344
Pathway
bmaf00440  Phosphonate and phosphinate metabolism
bmaf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmaf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    DM51_2042
Enzymes [BR:bmaf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.37  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase
     DM51_2042
SSDB
Motif
Pfam: PhnI PhnG
Other DBs
NCBI-ProteinID: AIP75395
UniProt: A0A3N4FNJ8
LinkDB
Position
1:2299819..2301036
AA seq 405 aa
MYVAVKGGERAIEASWRLLDQARRGDPAVPELSVAQIREQQRLAVARVMTEGSLYDEALA
ALAIKQAAGDLVEAIFLLRAYRTTLPRFGYTAPIDTGAMRLERRISATFKDIPGGQLLGP
TYDYTQRLLDFALLAEGDAARHEPHEAESARAAADAGSPPPHATHAPPPAAARVIALLND
EGLIEEERPTAVGAEPGDLSREPLAFPADRATRLQNLARGDEGFLLAMGYATQRGYGHSH
PFAGELRFGAVAVEMALDELDELDGETIEIGELDVTECQMINHFSGGDGEPPRFTQGYGL
AFGHSERKAIAMALVDRALRASELGEAAHSPPQDQEFVLSHSDNVEASGFVQHLKLPHYV
DFQSELELVRRLRAGHAAQAGAGANAHENAPARAERADTHTEESR
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgtacgtggcagtcaagggcggcgagcgggcgatcgaggcgtcgtggcgtttgctcgac
caagcgcggcgcggcgaccccgccgtgcccgagctgagcgtcgcgcagattcgcgagcag
cagcgcctcgcggtcgcgcgcgtgatgacggaaggctcgctgtacgacgaggcgctggcg
gcgctcgcgatcaagcaggcggcgggcgatctcgtcgaggcgatcttcctgctgcgcgca
taccggacgacgctgccgcgcttcggctacaccgcgccgatcgataccggcgcgatgcgg
ctcgagcgacggatctcggcaacgttcaaggacatcccgggcggccagttgctcggcccg
acctacgattacacgcagcggctgctcgatttcgcgctgctcgccgaaggcgacgcagcg
cggcacgagccgcacgaggccgaatcggcgcgcgccgcggccgacgcaggctcgccgccg
ccgcatgcgacgcatgcgccgccgcccgcggctgcgcgcgtgatcgcgctcctgaacgac
gaaggcctgatcgaagaggagcggccgacggcggtcggcgccgagccgggcgacctgtcg
cgcgagccgctcgcgtttccggccgatcgcgcgacgcgcctgcagaatctcgcacgcggc
gacgaaggttttctgctcgcgatgggctacgcgacgcagcgcggctacggtcattcgcat
ccgttcgcgggcgagctgcgctttggcgccgtcgccgtcgaaatggcgctcgacgagctc
gacgagctcgacggcgagacgatcgagatcggcgagctcgacgtgaccgagtgccagatg
atcaaccatttttccggcggcgacggcgagccgcctcgcttcacgcagggctacggcctc
gcgttcggccattcggagcgcaaggcgatcgcgatggcgctcgtcgatcgcgcgctgcgc
gcgtccgagctcggcgaagccgcgcactcgccgccgcaggatcaggagttcgtgctgtcg
cacagcgacaacgtcgaggcgtccggcttcgtccaacacctgaagctgccgcactacgtc
gatttccagtccgagctcgagctcgtgcgccgcctgcgcgccgggcatgcggcgcaggcg
ggagcgggcgcgaacgcgcacgagaacgcgcccgcccgcgccgaacgcgccgacacgcac
accgaggagtcccgatga

DBGET integrated database retrieval system