KEGG   Burkholderia mallei FMH 23344: DM51_2043
Entry
DM51_2043         CDS       T03523                                 

Definition
(GenBank) phosphonate metabolism PhnJ family protein
  KO
K06163  alpha-D-ribose 1-methylphosphonate 5-phosphate C-P lyase [EC:4.7.1.1]
Organism
bmaf  Burkholderia mallei FMH 23344
Pathway
bmaf00440  Phosphonate and phosphinate metabolism
bmaf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmaf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    DM51_2043
Enzymes [BR:bmaf01000]
 4. Lyases
  4.7  carbon-phosphorus lyases
   4.7.1  carbon-phosphorus lyases (only sub-subclass identified to date)
    4.7.1.1  alpha-D-ribose 1-methylphosphonate 5-phosphate C-P-lyase
     DM51_2043
SSDB
Motif
Pfam: PhnJ
Other DBs
NCBI-ProteinID: AIP77360
UniProt: A0A3N4FNZ1
LinkDB
Position
1:2301033..2302007
AA seq 324 aa
MNAPDHCAAAAPDTHAAEGYNFAYLDEQTKRMTRRALLKAVAVPGYQVPFASREMPLPFG
WGTGGIQVTAALIGRDDTLKVIDQGSDETTNAVNIRRFFARTAGVATTTKTAQATIIQTR
HRVPETPLTERQILVYQVPMPEPLFRLEPRATECAKLHAHADYGLMRVKLYEDIVHHGSI
ATTYDYPVIVNGRYLSSPSPIPKFDNPKLHMNPALQLFGAGRERRIYAIAPYTPVASLDF
DDHPFEAQRWDAACALCGSRESFLDEMIVDDHGTRRFVCSDSDYCSDRRGGAQARADGDG
EGNGGGDGEMPAPLAAEQPLGETT
NT seq 975 nt   +upstreamnt  +downstreamnt
atgaacgcgcccgaccattgcgcggccgccgcgcccgacacgcacgccgccgaaggctac
aacttcgcgtacctcgacgagcagacgaagcggatgacccgccgcgcgctgctcaaggcg
gtcgcggtgccgggctatcaggtgccgttcgcgtcgcgcgagatgccgctgccgttcggc
tggggaacgggcggcattcaggtgacggccgcgctgatcggccgcgacgatacgctgaag
gtgatcgatcagggctccgacgaaacgacgaacgcggtcaacatccgtcgcttcttcgcg
cgcaccgcgggcgtcgcgacgacgacgaagacggcgcaagcgacgatcatccagacgcgc
caccgcgttccggagacgccgctcaccgagcgtcagatcctcgtctatcaggtgccgatg
ccggagccgctctttcgcctggagccgcgcgcgaccgaatgcgcgaagctgcacgcgcac
gccgattacgggctgatgcgcgtgaagctgtacgaggacatcgtgcatcacggcagcatc
gcgacgacgtacgattacccggtgatcgtcaacggccgctacctgagctcgccgtcgccg
atcccgaagttcgacaatccgaagctgcacatgaacccggcgctgcaactgttcggcgcg
gggcgcgagcgccgcatctacgcgattgcgccgtacacgccggtcgcgagcctcgatttc
gacgatcatccgttcgaagcccagcgctgggacgccgcgtgcgcgctgtgcggctcgcgc
gagagctttctcgacgagatgatcgtcgacgatcacggcacgcgccgcttcgtgtgctcg
gacagcgactattgcagcgaccgccgcggcggcgcgcaggcgcgcgccgacggcgacggc
gagggcaacggcggcggcgacggggagatgcccgcgccgctcgcggccgaacagccgctg
ggagagacgacatga

DBGET integrated database retrieval system