KEGG   Burkholderia mallei FMH 23344: DM51_2046
Entry
DM51_2046         CDS       T03523                                 

Gene name
phnM
Definition
(GenBank) phosphonate metabolism protein PhnM
  KO
K06162  alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase [EC:3.6.1.63]
Organism
bmaf  Burkholderia mallei FMH 23344
Pathway
bmaf00440  Phosphonate and phosphinate metabolism
bmaf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmaf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    DM51_2046 (phnM)
Enzymes [BR:bmaf01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.63  alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase
     DM51_2046 (phnM)
SSDB
Motif
Pfam: Amidohydro_1 Host_attach
Other DBs
NCBI-ProteinID: AIP75182
UniProt: A0A3N4G267
LinkDB
Position
1:2303592..2304725
AA seq 377 aa
MLISNARVVTRDDVFIGTVQIDGESIRAVSRGTTAARDADDWGGDYLLPGLVELHTDNLE
KHLAPRPGVYWNVDAAFVTHDAQVAAAGITTVFDALAIGTRLNVGVRGRDVQTQCADALA
RFASHGLLRAEHFLHLRCEIATEDVVDVFDSLARHPRLRLASVMDHTPGQRQWKDPQQWR
HYQERHRKWSDEEAATTIAELADEQQRYADAHRRAIVARCRALGVPVASHDDTVIEHVEQ
AAREGIALAEFPTTHAAAEAARARGIATVMGAPNLVRGGSHSGNVSALALARAGLLDILS
SDYVPSSLLCAAFDLVHQAHWSLPRAIDTVSGSPARHTGLRDRGEIAPGLRADFVRVALH
GTLPVPRATYVRGRRVV
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgttgatcagcaatgcgcgcgtcgtcacgcgcgacgacgttttcatcggcaccgtgcag
atcgacggcgaatcgatccgcgcggtgtcgcgcggaacgaccgccgcgcgcgacgccgac
gattggggcggcgactatctgctgcccgggctcgtcgagctgcataccgacaacctggag
aagcatctcgcgccgcggccgggcgtgtactggaacgtcgatgcggcgttcgtcacgcac
gacgcgcaggtcgcggcggcaggcatcacgacggtattcgacgcgctcgcgatcggcacg
cggctgaacgtcggcgtgcgcgggcgcgacgtgcagacgcagtgcgcggacgcgctcgcg
cgcttcgcgtcgcacgggctgctgcgcgccgagcacttcctgcacctgcgctgcgagatc
gcgacggaggacgtcgtcgacgtgttcgattcgctcgcgcgccatccgcgcctgcggctc
gcgtcggtgatggaccatacgccggggcagcggcagtggaaggatccgcagcaatggcgc
cactatcaggagcggcatcgcaagtggtccgacgaggaggcggcgacgacgatcgccgag
ctggccgacgagcagcagcgctacgcggacgcgcaccggcgcgcgatcgtcgcgcgctgc
cgcgcgctcggcgtgcccgtcgcgagtcatgacgacacggtgatcgagcacgtcgagcag
gcggcgcgggagggcatcgcgctcgccgagtttccgacgacgcacgcggcggccgaagcg
gcgcgcgcgcgcggcatcgcgacggtgatgggcgcgccgaacctcgtgcgcggcggctcg
cattcgggcaatgtgtcggcgctcgcgctcgcgcgggcggggctcctcgacatcctgtcg
tccgactacgtgccgtcgagcctgctatgcgcggcgttcgacctcgtgcaccaggcgcac
tggagcctgccgcgcgcgatcgacacggtgtcgggctcgccggcgcgccatacggggctt
cgcgatcgcggcgaaatcgcgccggggctgcgtgcggatttcgtgcgtgtcgcgctgcac
ggcacgctgcccgtgccgcgcgcgacatatgttcgcgggcgtcgcgtcgtgtag

DBGET integrated database retrieval system