KEGG   Burkholderia mallei FMH 23344: DM51_2184Help
Entry
DM51_2184         CDS       T03523                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bmaf  Burkholderia mallei FMH 23344
Pathway
bmaf00473  D-Alanine metabolism
bmaf00550  Peptidoglycan biosynthesis
bmaf01100  Metabolic pathways
bmaf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bmaf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DM51_2184
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DM51_2184
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DM51_2184
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmaf01011]
    DM51_2184
Enzymes [BR:bmaf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DM51_2184
Peptidoglycan biosynthesis and degradation proteins [BR:bmaf01011]
 Precursor biosynthesis
  Amino acid ligase
   DM51_2184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATPgrasp_ST ATP-grasp TTL ATP-grasp_3 ATP-grasp_4 ATPgrasp_YheCD PPR
Motif
Other DBs
NCBI-ProteinID: AIP75854
UniProt: A0A3N4GH88
LinkDB All DBs
Position
1:complement(2445413..2446351)
Genome map
AA seq 312 aa AA seqDB search
MSGIDPKRFGKVAVLLGGDSAEREVSLNSGRLVLQGLRDAGIDAHPFDPAQRPLAALKDE
GFVRAFNALHGGYGENGQIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGIPTPP
FETVMRGDDYAARAQDIVAKLGVPLFVKPASEGSSVAVEKVKSADALPAALEEAAKHDKI
VIVEKSIEGGGEYTACIAADLDLPLIRIVPAGEFYDYHAKYIANDTQYLIPCGLDAAKEA
EFKRIARRAFDVLGCTDWGRADFMLDAAGNPYFLEVNTAPGMTDHSLPPKAARAVGIGYS
ELVVKVLSLTLD
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggatcgatccgaaacgtttcggcaaggtggcggtgctgctcggcggggattcc
gccgagcgcgaggtatcgctgaactctggccggctggtgctgcagggcctgcgcgacgcg
ggcatcgacgcgcatccgttcgatccggcgcagcggccgctcgcggcgctcaaggacgaa
ggcttcgtgcgcgcgttcaacgcgctgcacggcggctacggcgagaacggccagatccag
ggcgcgctcgatttctacggcatccgctacacgggcagcggcgtgctcggctcggcgctc
gggctcgacaagttccgcacgaagctcgtctggcagcagacgggcattccgacgccgccg
ttcgagacggtgatgcgcggcgacgattatgcggcgcgcgcgcaggacatcgtcgcgaag
ctcggcgtgccgcttttcgtgaagccggcgagcgagggctcgagcgtcgcggtcgagaag
gtgaaaagcgccgatgcgttgcccgccgcactggaagaagcggcgaagcacgacaagatc
gtgatcgtcgagaagagcatcgaaggcggcggcgaatacaccgcgtgcatcgccgcggat
ctcgatctgccgctcatcaggatcgtgcccgcgggcgagttctacgactatcacgcgaag
tacatcgcgaacgacacgcaatacctgattccgtgcggcctcgacgcggcaaaggaagcc
gagttcaagcgcatcgcgcgccgcgcgttcgacgtgctcggctgcacggactggggccgc
gcggatttcatgctcgacgccgcgggcaacccgtatttcctcgaagtgaacaccgcgccg
gggatgaccgatcactcgctgccgccgaaggcggcgcgcgcggtgggcatcggctattcg
gagctggtggtgaaagtgctgtcgctcacgctcgattga

DBGET integrated database retrieval system