KEGG   Burkholderia mallei FMH 23344: DM51_2496
Entry
DM51_2496         CDS       T03523                                 

Definition
(GenBank) phosphopantetheine attachment site family protein
  KO
K02078  acyl carrier protein
Organism
bmaf  Burkholderia mallei FMH 23344
Pathway
bmaf00998  Biosynthesis of various secondary metabolites - part 2
bmaf01100  Metabolic pathways
bmaf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmaf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DM51_2496
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    DM51_2496
SSDB
Motif
Pfam: PP-binding_2 PP-binding
Other DBs
NCBI-ProteinID: AIP76441
UniProt: A0A3N4FSL8
LinkDB
Position
1:2765105..2765326
AA seq 73 aa
MNAFYEGLAEIFEIDASEVTPALALGEHNWDSLAIVSTIALADDCFGVLLNGQALGNCKT
VADIDALVAAQKG
NT seq 222 nt   +upstreamnt  +downstreamnt
atgaacgcattctacgaaggcctcgcggaaatcttcgagatcgacgcgagcgaagtcacg
cccgcgctcgcgctcggcgagcacaactgggattcgcttgcgatcgtgtcgacgatcgcg
ctcgccgacgactgcttcggcgtgctgctcaacggccaggcgctcggcaactgcaagacg
gtcgccgatatcgacgcgctcgtcgcggcgcaaaagggctga

DBGET integrated database retrieval system