KEGG   Burkholderia mallei FMH 23344: DM51_3191Help
Entry
DM51_3191         CDS       T03523                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bmaf  Burkholderia mallei FMH 23344
Pathway
bmaf00250  Alanine, aspartate and glutamate metabolism
bmaf00410  beta-Alanine metabolism
bmaf00640  Propanoate metabolism
bmaf00650  Butanoate metabolism
bmaf01100  Metabolic pathways
bmaf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmaf00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    DM51_3191 (gabT)
   00650 Butanoate metabolism
    DM51_3191 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DM51_3191 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DM51_3191 (gabT)
Enzymes [BR:bmaf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     DM51_3191 (gabT)
Amino acid related enzymes [BR:bmaf01007]
 Aminotransferase (transaminase)
  Class III
   DM51_3191 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIP74688
UniProt: A0A290YG44
LinkDB All DBs
Position
2:25114..26397
Genome map
AA seq 427 aa AA seqDB search
MNNADLHARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRHPR
IVKAIADQLGQFTHTAYQIVPYASYVELAEKINARAPIAQPKKTAFFTTGAEAVENAVKI
ARAYTGRPGVIAFAGGFHGRTMMGMALTGKVAPYKIGFGPFPGDVFHAPYPNALHGVTSA
DSIAAVETLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVRALRKLCDAHGILLIADEV
QTGFARTGKLFAMEHYDVSADLMTIAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVAAAHAVLDVIDEEKLAERATVLGDKLKAKLAALRAELPQIVDVRGPGAMVAAEFVD
PHTRASDAAFTKRVQTLALERGLLLLICGVDANVIRFLFPLTIEDAVFDEALGILESVLR
EAVGVPA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaatgccgatctgcacgcccgcaagaacgccgcgacgccgcgtggcgtcggcgtg
atgtgcgatttctacgccgcgcgcgccgagaacgccgagctgtgggatgtcgagggccgc
cgcttcatcgatttcgcggccggcatcgcggtcctgaacacgggccatcgccatccgagg
atcgtgaaggcgatcgccgaccagctcgggcaattcacgcataccgcgtatcagatcgtg
ccgtacgcgtcgtacgtcgaactcgccgagaagatcaacgcgcgcgcgccgatcgcgcag
ccgaagaagaccgcgttcttcacgacgggcgcggaagcggtcgagaacgcggtgaagatc
gcgcgcgcctacaccggccggccgggcgtgatcgcgttcgcgggcggcttccacggccgc
acgatgatgggcatggcgctcaccggcaaggtcgcgccgtacaagatcggcttcggcccg
ttcccgggcgacgtgttccacgcgccgtacccgaacgcgttgcacggcgtgacgagcgcc
gattcgatcgcggccgtcgaaacgctgttcaaggccgacatcgatccgaagcgcgtcgcc
gcgatcatcttcgagccggtgcagggcgaaggcggcttcaacccggcgcccgccgagttc
gtgcgcgcgctgcgcaagctgtgcgacgcgcacggcattctcctcatcgccgacgaagtg
cagacgggcttcgcgcgcacgggcaagctgttcgcgatggagcactacgacgtctcggcc
gacctgatgacgatcgcgaagagcctcgcgggcgggatgccgctgtcgggcgtcgtcggc
cgcgcggacgtgatggacgcggccgcgccgggcggcctgggcggcacgtacgcgggcaat
ccgctcgccgtggccgccgcgcacgcggtgctcgacgtgatcgacgaggagaagctcgcc
gagcgcgcgaccgtgctcggcgacaagctgaaggcgaagctcgccgcgctgcgcgccgag
ctgccgcagatcgtcgacgtgcgcggcccgggcgcgatggtcgccgcggaattcgtcgat
ccgcacacgcgcgcgtccgatgccgcgttcacgaagcgcgtgcagacgctcgcgctcgag
cgcgggctgctgctgctcatctgcggcgtcgacgcgaacgtgatacgtttcctgtttcct
ctcaccatcgaggatgccgtgttcgacgaagcgctcggcattctcgagagcgtgctgagg
gaagcggtgggcgtgcccgcctga

DBGET integrated database retrieval system