KEGG   Burkholderia mallei FMH 23344: DM51_322
Entry
DM51_322          CDS       T03523                                 

Gene name
acpP
Definition
(GenBank) acyl carrier protein
  KO
K02078  acyl carrier protein
Organism
bmaf  Burkholderia mallei FMH 23344
Pathway
bmaf00998  Biosynthesis of various secondary metabolites - part 2
bmaf01100  Metabolic pathways
bmaf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmaf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DM51_322 (acpP)
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    DM51_322 (acpP)
SSDB
Motif
Pfam: PP-binding PP-binding_2 Ribosomal_L50 DUF1896 DUF1493
Other DBs
NCBI-ProteinID: AIP77484
LinkDB
Position
1:351886..352125
AA seq 79 aa
MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA
EKITTVQQAIDYARANVKA
NT seq 240 nt   +upstreamnt  +downstreamnt
atggacaacatcgaacaacgcgtgaagaagatcgtcgccgaacaactgggcgtcgccgaa
gccgaaatcaagaacgaagcgtcgttcgtgaacgacctcggcgcggactcgctcgacacg
gtcgagctggtgatggcgctcgaagacgagttcggcatggaaatcccggatgaagaggcc
gagaagatcacgaccgttcagcaagcgatcgactacgctcgcgcgaacgtcaaggcgtaa

DBGET integrated database retrieval system