KEGG   Burkholderia mallei FMH 23344: DM51_3440Help
Entry
DM51_3440         CDS       T03523                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur family protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bmaf  Burkholderia mallei FMH 23344
Pathway
bmaf00020  Citrate cycle (TCA cycle)
bmaf00190  Oxidative phosphorylation
bmaf00650  Butanoate metabolism
bmaf01100  Metabolic pathways
bmaf01110  Biosynthesis of secondary metabolites
bmaf01120  Microbial metabolism in diverse environments
bmaf01130  Biosynthesis of antibiotics
bmaf01200  Carbon metabolism
Module
bmaf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmaf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bmaf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bmaf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DM51_3440
   00650 Butanoate metabolism
    DM51_3440
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DM51_3440
Enzymes [BR:bmaf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DM51_3440
    1.3.5.4  fumarate reductase (quinol)
     DM51_3440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_7 Fer4_18 Fer4_4 Fer4
Motif
Other DBs
NCBI-ProteinID: AIP74599
UniProt: A0A3N4G8Q1
LinkDB All DBs
Position
2:complement(318585..319286)
Genome map
AA seq 233 aa AA seqDB search
MAKRIFEIYRYDPDKDAAPRMQTYELEIQHERMLLDALVKLKSVDETLSFRRSCREGVCG
SDAMNINGKNGLACLTNLNDLPQKIVLRPLPGLPVVRDLICDFTQFFNQYHSIRPYLIND
EPPPEKERLQSPEERDELDGLYECILCASCSTSCPSFWWNPDKFVGPAGLLQAYRFIADS
RDRATGERLDNLDDPYRLFRCHTIMNCVDVCPKGLNPTKAIGKIKELMVRRAV
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacgcattttcgaaatctaccgctacgatccggacaaggacgccgcgccgcgc
atgcagacgtacgagctggagatccagcacgagcggatgctgctcgatgcgctcgtcaag
ctgaagtcggtcgacgagacgctgtcgttccgccgctcgtgccgcgaaggcgtgtgcggc
tcggacgcgatgaacatcaacggcaagaacggcctcgcgtgcctgacgaacctgaacgac
ctgccgcagaagatcgtgctgcgtccgctgccgggcctgcctgtcgtgcgcgatctgatc
tgcgacttcacgcagttcttcaaccagtaccactcgatccgcccgtacctgatcaacgac
gagccgccgcccgagaaggagcgtctgcaatcgccggaagagcgcgacgagctcgacggc
ctgtacgagtgcattctgtgcgcgagctgctcgacgtcgtgcccgagcttctggtggaat
ccggacaagttcgtcggcccggcgggcctgctgcaggcgtatcgcttcatcgcggacagc
cgcgatcgcgcgacgggcgagcgcctcgacaacctcgacgatccgtatcgcctgttccgc
tgccacacgatcatgaactgcgtcgacgtgtgcccgaagggcctgaacccgacgaaggcg
atcggcaagatcaaggaattgatggttcgtcgcgcggtctga

DBGET integrated database retrieval system