KEGG   Burkholderia mallei FMH 23344: DM51_3441Help
Entry
DM51_3441         CDS       T03523                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bmaf  Burkholderia mallei FMH 23344
Pathway
bmaf00020  Citrate cycle (TCA cycle)
bmaf00190  Oxidative phosphorylation
bmaf00650  Butanoate metabolism
bmaf01100  Metabolic pathways
bmaf01110  Biosynthesis of secondary metabolites
bmaf01120  Microbial metabolism in diverse environments
bmaf01130  Biosynthesis of antibiotics
bmaf01200  Carbon metabolism
Module
bmaf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmaf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bmaf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bmaf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DM51_3441 (sdhA)
   00650 Butanoate metabolism
    DM51_3441 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DM51_3441 (sdhA)
Enzymes [BR:bmaf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DM51_3441 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     DM51_3441 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C FAD_binding_3 DAO Thi4 Pyr_redox_2 HI0933_like GIDA FAD_oxidored Lycopene_cycl Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AIP74539
UniProt: A0A3N4FFE3
LinkDB All DBs
Position
2:complement(319308..321083)
Genome map
AA seq 591 aa AA seqDB search
MAAIKTSLPRRKFDVVIVGAGGSGMRASLQLSRAGLSVCVLSKVFPTRSHTVAAQGGIGA
SLGNMSEDNWHYHFYDTIKGSDWLGDQDAIEFMCREAPNVVYELEHFGMPFDRNADGTIY
QRPFGGHTANYGEKPVQRACAAADRTGHALLHTLYQQNVAAKTQFFVEWMALDLIRDADG
DVLGVTALEMETGDVYILEGKTTLFATGGAGRIFAASTNAFINTGDGLGMAARSGIALQD
MEFWQFHPTGVAGAGVLITEGVRGEGGILRNANGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGVGPNKDHVLLDLSHIGAETIMKRLPSIREIALKFANVDCIKEPIPVVPTIHYQ
MGGIPTNIHGQVVGTSRDHKEPINGFYAVGECSCVSVHGANRLGTNSLLDLVVFGRAAGN
HIVEHVKNQRDHKPLPADAADFSLSRLAKLEKSTSGEYTQDIANDIRATMQKHAGVFRTS
ALLKEGVEQMAGLKERAAAVHLKDKSKVFNTARVEALELANLIEVARATMVSAEARKESR
GAHAHSDYEHRDDENWLRHTLWYSEGDRLDYKPVQMKPLTVESVPPKARTF
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaatcaaaacttccctgccgcgtcgcaagttcgacgtggtgatcgtcggcgcg
ggcggctcggggatgcgcgcgtcgctgcaactgtcgcgcgcgggcctctccgtatgcgtg
ctctcgaaggtgttcccgacccgttcgcacacggtcgccgcgcaaggcgggatcggcgcg
tcgctcggcaacatgagcgaagacaactggcactaccacttctacgacacgatcaagggc
tccgactggctcggcgatcaggacgcgatcgagttcatgtgccgcgaggcgccgaacgtc
gtgtacgagctcgagcacttcggcatgccgttcgaccgtaacgcggacggcacgatctac
cagcgtccgttcggcggccacacggccaactacggcgagaagccggtccagcgcgcgtgc
gcggcggccgaccgtaccggccacgcgctgctgcacacgctgtatcagcaaaacgtcgcg
gcgaagacgcagttcttcgtcgaatggatggcactcgacctgatccgcgacgcggacggc
gacgtgctcggcgtgacggccctcgaaatggaaacgggcgacgtctacatcctcgaaggc
aagaccacgctgttcgccacgggcggcgcgggccggatcttcgcggcgtcgaccaacgcg
ttcatcaataccggcgacggcctcggcatggccgcgcgttcgggcatcgcgctgcaggac
atggaattctggcaattccacccgacgggcgtcgcgggcgcgggcgtgctgatcaccgaa
ggcgtgcgcggcgaaggcggcattctgcgcaacgcgaacggcgagcgcttcatggagcgc
tacgcgccgacgctgaaggatctggcgccgcgcgatttcgtgtcgcgctcgatggaccag
gaaatcaaggaaggccgcggcgtgggcccgaacaaggaccacgtgctgctcgacctgtcg
cacatcggcgccgagacgatcatgaagcgtctgccgtcgatccgcgaaatcgcgctgaag
ttcgcgaacgtcgactgcatcaaggaaccgattcccgtcgtgccgacgatccactaccag
atgggcggcatcccgaccaacatccacggccaggtggtgggcacgtcgcgcgatcacaag
gagccgatcaacggcttctatgcggtgggcgaatgctcgtgcgtgtccgtgcacggcgcg
aaccgcctcggcacgaactcgctgctcgacctcgtcgtgtttggtcgcgcggccggcaac
cacatcgtcgagcacgtgaagaaccagcgcgatcacaagccgctgccggccgacgccgcc
gacttctcgctgtcgcgcctcgcgaagctcgagaagtcgacctcgggcgagtacacgcag
gacatcgccaacgacatccgcgcgacgatgcaaaagcatgccggcgtgttccgcacgtcc
gcgctgctcaaggaaggcgtcgagcaaatggcgggcctgaaggagcgcgccgccgccgtc
cacctgaaggacaagtcgaaggtgttcaacaccgcgcgcgtcgaagcgctcgaactggcg
aacctgatcgaggtcgcgcgcgcgacgatggtgtcggcggaagcgcgcaaggaaagccgc
ggcgcgcacgcgcacagcgattacgagcaccgcgacgacgagaactggctgcgtcacacg
ctgtggtacagcgaaggcgatcgcctcgactacaagcccgtccaaatgaagccgctgacg
gtcgagtccgtgccgccgaaggcgcgtacgttctaa

DBGET integrated database retrieval system