KEGG   Burkholderia mallei FMH 23344: DM51_3462
Entry
DM51_3462         CDS       T03523                                 

Gene name
aepY
Definition
(GenBank) phosphonopyruvate decarboxylase
  KO
K09459  phosphonopyruvate decarboxylase [EC:4.1.1.82]
Organism
bmaf  Burkholderia mallei FMH 23344
Pathway
bmaf00440  Phosphonate and phosphinate metabolism
bmaf00998  Biosynthesis of various secondary metabolites - part 2
bmaf01100  Metabolic pathways
bmaf01110  Biosynthesis of secondary metabolites
bmaf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmaf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    DM51_3462 (aepY)
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    DM51_3462 (aepY)
Enzymes [BR:bmaf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.82  phosphonopyruvate decarboxylase
     DM51_3462 (aepY)
SSDB
Motif
Pfam: TPP_enzyme_C TPP_enzyme_N
Other DBs
NCBI-ProteinID: AIP75033
LinkDB
Position
2:346464..347582
AA seq 372 aa
MPCSYLTPFINYVLQDPALHYVSAANEGDAVALVAGATLGGRRGIAMMQNSGLGNAVSPL
TSLTWTFRLPQLLIVTWRGQPGVPDEPQHALMGPITPAMLDTMEIPWETFPTQADAIGPA
LDRAIAHMDATGRPYALVMQKGSVAPHALEHASMPERRAHAAARVTPGAAAPSAWPTRHD
ALARIVARTPADSTVVLASTGFCGRELYALDDRPNQLYMVGSMGCVTPLALGLALARPDL
TVVALDGDGAALMRMGAFATLGAYGPPNLVHLLLDNGAHESTGGQATVSQYVSFAGIAAA
CGYATAIEGDDLGVLDAALDAARAGEQAVEHGGAHFARLSIRTGVPDGLPRPTVTPVDVK
TRLMRHIGAMPA
NT seq 1119 nt   +upstreamnt  +downstreamnt
gtgccctgctcgtatctgacgccgttcatcaattacgtgctgcaggacccggcgctccat
tacgtatcggcggccaacgaaggcgacgcggtcgcgctcgtcgcgggcgcgacgctcggc
ggccggcgcgggatcgcgatgatgcagaactcggggctcggcaacgcggtgagcccgctc
acgtcgctcacgtggacgttcaggctgccgcagctcctgatcgtcacgtggcgcggccag
ccgggcgtgcccgacgagccgcagcacgcgctgatgggcccgatcacgcccgcgatgctc
gacacgatggaaattccgtgggagacgttcccgacgcaggccgacgcgatcggcccggcg
ctcgatcgcgcgatcgcgcacatggacgcgacgggccgcccgtacgcgctcgtgatgcag
aaaggcagcgtcgcgccgcacgcgctcgagcatgcctcgatgcccgagcgccgcgcgcac
gccgccgcgcgcgtgacgcccggcgcggccgcgccttcggcatggccgacgcgccatgac
gcgctcgcgcggatcgtcgcgcgcacgccggccgactcgacggtcgtgctcgcgtcgacg
ggcttctgcggccgcgagctgtacgcgctcgacgatcgcccgaaccagctctacatggtc
ggctcgatgggctgcgtgacgccgctcgcgctcggcctcgcgctcgcgcggccggacctg
accgtcgtcgcgctcgacggcgacggcgccgcgctgatgcgcatgggcgcgttcgcgacg
ctcggcgcgtacggcccgccgaacctcgtgcatctgctgctcgacaacggcgcgcatgaa
tcgacgggcgggcaagccacggtgtcgcaatacgtgtcgttcgcgggcatcgcggccgca
tgcggctacgcgacggcgatcgagggcgacgatctcggcgtgctcgatgcggcgctcgac
gcggcgcgcgcgggcgagcaggccgtcgagcacggcggcgcgcacttcgcgcgcctgtcg
atccgcacgggcgtgcccgacggcctgccccgcccgacggtgacgcccgtcgacgtgaaa
acgcgcctgatgcgccacatcggcgcgatgccggcctga

DBGET integrated database retrieval system