KEGG   Burkholderia mallei FMH 23344: DM51_3463
Entry
DM51_3463         CDS       T03523                                 

Definition
(GenBank) 2-aminoethylphosphonate aminotransferase family protein
  KO
K03430  2-aminoethylphosphonate-pyruvate transaminase [EC:2.6.1.37]
Organism
bmaf  Burkholderia mallei FMH 23344
Pathway
bmaf00440  Phosphonate and phosphinate metabolism
bmaf01100  Metabolic pathways
bmaf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmaf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    DM51_3463
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bmaf01007]
    DM51_3463
Enzymes [BR:bmaf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.37  2-aminoethylphosphonate---pyruvate transaminase
     DM51_3463
Amino acid related enzymes [BR:bmaf01007]
 Aminotransferase (transaminase)
  Class V
   DM51_3463
SSDB
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP Aminotran_1_2 Beta_elim_lyase SHMT DegT_DnrJ_EryC1
Other DBs
NCBI-ProteinID: AIP74374
UniProt: A0A3N4FFG8
LinkDB
Position
2:347597..348664
AA seq 355 aa
MLLLNPGPVTLTERVRQSLLQPDLCHRESEFFDLQDEARARLVAAYALDPAEWSAVLMTG
SGTAAVESMIAALVPENGKLLVIENGVYGERITQIATQYRIAHDVLKHDWMQAPDLARVA
EKLDADRAITHVAVIHHETTTGRLNDLDALAAVCRARGVRMLVDGVSSFGAEAVDFAGGD
IDALAATANKCLHGVPGAAFVIVRRRALASAASRTYYLDLGRLAKLQDARNTPFTPSVHA
YYALVEALREFDEAGGWRARHARYAALAEQVRAGLAARGMPLVLPDGESSVVLRAYRLPA
GVAYEQLHDGLKARGFVIYAGQGGLSSALFRVSTMGAIEPADVERLLDGFTALAR
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgctgttgctgaatcccggtcccgtgacgctgacggagcgtgtgcgccaaagcctgctg
cagccggacctgtgccaccgcgaaagcgaattcttcgatctgcaggacgaggcgcgcgcg
cggctcgtcgccgcgtacgcgctcgatccggccgaatggagcgcggtgctgatgacgggc
tccggcacggccgcggtcgagagcatgatcgccgcgctcgtgccggaaaacggcaagctg
ctcgtgatcgagaacggcgtgtacggcgagcggatcacgcagatcgcgacgcagtaccgg
atcgcgcacgacgtgctgaaacacgactggatgcaggcgccggatctcgcgcgcgtcgcc
gagaagctcgacgcggatcgcgcgatcacgcatgtcgcggtgatccatcacgaaacgacc
acgggccgcctgaacgacctcgacgcgctcgccgccgtgtgccgcgcgcgcggcgtgcgc
atgctcgtcgacggcgtgagcagcttcggcgcggaggcggtcgatttcgcgggcggcgac
atcgacgcgctcgccgcgaccgcgaacaagtgcctacacggcgtgccgggcgcggcgttc
gtgatcgtgcgccgccgcgcgctcgcgagtgccgcgagccgcacctactacctcgatctc
ggccggctcgcgaagctgcaggacgcgcgcaacacgccgttcacgccgtcggtgcacgcg
tactacgcgctcgtcgaggcgctgcgcgagttcgacgaggcgggcggctggcgcgcgcgc
cacgcgcgctacgcggcgctcgccgaacaggtgcgcgccggcctcgccgcgcgcggcatg
ccgctcgtgctgccggacggcgaatcgtcggtcgtgctgcgcgcgtaccggctgcccgcc
ggcgtcgcgtacgagcaactgcacgacggcctgaaagcgcgcggcttcgtgatctacgcg
ggccagggcgggctgtcgagcgcgttgttccgcgtgtcgacgatgggcgcgatcgagccc
gcggacgtcgagcgcctcctcgacggattcaccgcgctcgcgcgctga

DBGET integrated database retrieval system