KEGG   Burkholderia mallei FMH 23344: DM51_4163Help
Entry
DM51_4163         CDS       T03523                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bmaf  Burkholderia mallei FMH 23344
Pathway
bmaf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmaf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    DM51_4163
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmaf02044]
    DM51_4163
Secretion system [BR:bmaf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   DM51_4163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: AIP73539
UniProt: A0A3N4FW01
LinkDB All DBs
Position
2:1175616..1176143
Genome map
AA seq 175 aa AA seqDB search
MANALVDYFLQIDGVEGESTDQQYPGLIQIQSWQWAEENSGRWGFGSGGGAGKVEMKDFE
FRMVSNKASPKLFLMCATGEHIQNAKLICRKSGKGQQEFLTISFASGLVSSFRTLGNMPI
SQLGHASGEVDGVLPTDQIRINFVQIEFEYREQRNDGTMGAVIKAGYDLKQNAPI
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgctttggttgattacttcttgcagatcgatggcgtcgagggtgagtcgacc
gatcagcaatatcccggtctgatccagatccagagctggcagtgggcggaagagaactcg
ggccgctggggcttcggcagcggcggcggcgcgggcaaggtcgagatgaaggacttcgag
ttccgcatggtgtcgaacaaggcgtcgccgaagctgttcctgatgtgcgcgacgggtgag
cacatccagaatgcgaagctgatctgccgcaagtcgggcaagggccagcaggagttcctg
acgatctcgttcgcgagcggcctcgtgtcgtcgttccgcacgctcggcaacatgccgatc
tcgcagctcggtcacgcgagcggcgaagtcgacggcgtgctgccgacggatcagatccgc
atcaacttcgtccagatcgagttcgagtaccgcgagcagcgcaacgacggcacgatgggc
gccgtgatcaaggcgggctacgacctgaagcagaacgcgccgatctaa

DBGET integrated database retrieval system