KEGG   Burkholderia mallei FMH 23344: DM51_4342
Entry
DM51_4342         CDS       T03523                                 

Definition
(GenBank) P-hydroxycinnamoyl CoA hydratase/lyase
  KO
K18383  feruloyl-CoA hydratase/lyase [EC:4.1.2.61]
Organism
bmaf  Burkholderia mallei FMH 23344
Pathway
bmaf00998  Biosynthesis of various secondary metabolites - part 2
bmaf01100  Metabolic pathways
bmaf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmaf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    DM51_4342
Enzymes [BR:bmaf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.61  feruloyl-CoA hydratase/lyase
     DM51_4342
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: AIP74268
UniProt: A0A3N4FWI5
LinkDB
Position
2:1374417..1375244
AA seq 275 aa
MSYEGRWKTVEVIVDGAIAWVTLNRPDKRNAMSPTLNAEMIDVLEAIELDPEARVLVLTG
EGEAWTAGMDLKEYFREIDAGPEILQEKIRRDASRWQWQLLRMYAKPTIAMVNGWCFGGG
FSPLVACDLAIAADEAVFGLSEINWGIPPGNLVSKAMADTVGHRQALYYIMTGETFTGAQ
AAQMGLVNRSVPRAQLRDAVRALAAKLLDKNPVVLRNAKHGFKRCRELTWEQNEDYLYAK
LDQAQLRDPEHGREQGLKQFLDDKTIKPGLQAYRR
NT seq 828 nt   +upstreamnt  +downstreamnt
atgagttatgaaggtcgctggaaaaccgtcgaggtgatcgtcgacggcgcaatcgcatgg
gtgacgctgaatcgtcccgacaagcgcaacgcgatgagcccgacgctgaacgcggagatg
atcgacgtgctggaggcgatcgagctcgatcccgaagcgcgggtgctcgtgctgacgggc
gagggcgaggcgtggacggccggcatggacctgaaggagtactttcgcgaaatcgacgcc
ggccccgagatcctgcaggagaagatccgccgcgacgcgagccgctggcagtggcagttg
ctgcgcatgtatgcgaagccgacgatcgcgatggtcaacggctggtgcttcggcggcggg
ttctcgccgctcgtcgcgtgcgatctcgcgatcgcggccgacgaggccgtgttcggcctg
tcggagatcaactggggcattccgcccggcaatctcgtcagcaaggcgatggccgatacg
gtcggccatcgtcaggcgctgtactacatcatgacgggcgagaccttcacgggcgcgcag
gccgcgcagatggggctcgtcaaccggagcgtgccgcgcgcgcaactgcgcgacgcggtg
cgcgcgctcgccgcgaagctgctcgacaagaatccggtcgtgctgcgcaacgcgaagcac
ggcttcaagcgctgccgcgagctcacgtgggagcagaacgaggactacctgtacgcgaag
ctcgatcaggcgcagttgcgcgatcccgagcacgggcgcgagcagggcctcaagcaattc
ctcgacgacaagacgatcaagccgggcttgcaggcgtacaggcgttga

DBGET integrated database retrieval system