KEGG   Burkholderia mallei FMH 23344: DM51_4548
Entry
DM51_4548         CDS       T03523                                 

Gene name
phnW
Definition
(GenBank) 2-aminoethylphosphonate--pyruvate transaminase
  KO
K03430  2-aminoethylphosphonate-pyruvate transaminase [EC:2.6.1.37]
Organism
bmaf  Burkholderia mallei FMH 23344
Pathway
bmaf00440  Phosphonate and phosphinate metabolism
bmaf01100  Metabolic pathways
bmaf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmaf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    DM51_4548 (phnW)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bmaf01007]
    DM51_4548 (phnW)
Enzymes [BR:bmaf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.37  2-aminoethylphosphonate---pyruvate transaminase
     DM51_4548 (phnW)
Amino acid related enzymes [BR:bmaf01007]
 Aminotransferase (transaminase)
  Class V
   DM51_4548 (phnW)
SSDB
Motif
Pfam: Aminotran_5 Aminotran_1_2
Other DBs
NCBI-ProteinID: AIP73854
UniProt: A0A3N4FRV1
LinkDB
Position
2:complement(1616553..1617662)
AA seq 369 aa
MPERDPILLTPGPLTTSRMTRDAMLRDWGSWDAAFNRLTKSVCADLVRIAGGGDAYVCVP
LQGSGTFAVEATLGTLVPRDARVLVPNNGAYCARIAAILRRLGIAHVELPFAEDEPASAH
AIDAALARDARLTHVALVHLETSAGLLNPLDDIAAVCRARGRALIVDAMSSFGALPIALA
ASGIDALISASGKCLEGVPGMGFAIVRRSALEAAEGRSPSVALDLHDQYAYMQRTSQWRF
TPPTHVLAALRAALDQFFDEGGQPARGARYARNCATLVDGMRALGFEPFLDARAQASVIV
TFYAPADPAYAFPAFYAAVRDAGYVLYPGKLTTADTFRVGCIGALGADEMRGAVAAIGGA
LESLGIAMR
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgccagaacgtgatcccatcctgttgacgcccggcccgctgacgacctcgcgcatgacg
cgcgacgcgatgctgcgcgactggggctcgtgggacgccgctttcaaccggctgacgaag
agcgtctgcgcggatctcgtgcggatcgcgggcggcggcgacgcatatgtgtgcgtgccg
ctgcaaggcagcggcacgtttgcggtcgaagcgacgctcggcacgctcgtgccgcgcgac
gcccgcgtgctcgtgccgaacaacggcgcgtactgcgcgcggatcgcggcgatcctgcgc
cggctcggcatcgcgcacgtcgagctgccgttcgccgaggacgagccggcgagcgcgcac
gcgatcgacgcggcgctcgcgcgcgacgcgcgcctcacgcacgtcgcgctcgtgcatctg
gagacgagcgccggcctgctgaacccgctcgacgacatcgccgccgtctgccgcgcgcgc
ggcagggcgctgatcgtcgacgcgatgagctcgttcggcgcgctgccgatcgcgctcgcg
gcaagcggcatcgacgcgctgatctcggcgagcggcaagtgcctggaaggagtgcccggc
atgggcttcgcgatcgtgcggcgttcggcgctcgaagcggccgaggggcgctcgccgtcg
gtcgcgctcgatctgcacgaccagtacgcatacatgcagcgcacgtcgcaatggcgcttc
acgccgccgacgcacgtgctcgccgcgctgcgcgccgcgctcgaccagttcttcgacgaa
ggcgggcagccggcgcgcggcgcgcgctacgcgcggaactgcgcgacgctcgtcgacggc
atgcgcgcgctcggcttcgagccgtttctcgacgcgcgcgcgcaggcgagcgtgatcgtc
acgttctacgcgcccgccgatcccgcgtatgcgttcccggcgttctacgcggccgtgcgc
gacgcgggctacgtgctgtatccgggcaagctgacgacggccgacacgtttcgcgtcggc
tgcatcggcgcgctcggcgccgacgagatgcgcggcgcggtggcggcgatcggcggcgcg
ctcgaatcgctcggaatcgcgatgcggtga

DBGET integrated database retrieval system