KEGG   Burkholderia mallei FMH 23344: DM51_4553
Entry
DM51_4553         CDS       T03523                                 

Gene name
phnA
Definition
(GenBank) phosphonoacetate hydrolase
  KO
K19670  phosphonoacetate hydrolase [EC:3.11.1.2]
Organism
bmaf  Burkholderia mallei FMH 23344
Pathway
bmaf00440  Phosphonate and phosphinate metabolism
bmaf01100  Metabolic pathways
bmaf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmaf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    DM51_4553 (phnA)
Enzymes [BR:bmaf01000]
 3. Hydrolases
  3.11  Acting on carbon-phosphorus bonds
   3.11.1  Acting on carbon-phosphorus bonds (only sub-subclass identified to date)
    3.11.1.2  phosphonoacetate hydrolase
     DM51_4553 (phnA)
SSDB
Motif
Pfam: Phosphodiest
Other DBs
NCBI-ProteinID: AIP73157
LinkDB
Position
2:1621985..1623226
AA seq 413 aa
MNRHIEVNGRVYRMPAEPTVAVCVDGCEYDYLEEAASAGVAPFLARMLREGSAFEADCVI
PSFTNPNNLSIVCGAPPSVHGICGNFFWDQNAQGGAGAAVMMNDPAYLRAGTLLAAAADA
GAKVAVVTAKDKLRRLLGWRMRGVCFSAEKANQANLGENGIADVLDFVGLPSPDVYSAAL
SEFVLAAGVRLAQSRRADLMYLSTTDYVQHKCAPGSEGANAFYAMMDRYLAALDALGWVI
GVTADHGMNAKHDPRTGEPNVVYLQDALDAWLGPRLARVILPITDPYVVHHGALGSFATI
YVEQGVDAGTVIGRLREFDGVELALDNATAAERFELPADRIGDVVVVGRRDVVLGTRARE
HDLSGLTVPLRSHGGLSEQRVPLLFNRRIEHVEPGRRLRNFDLFDLALNRTVQ
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgaatcgacacatcgaagtcaacggccgcgtctaccggatgccggccgagccgacggtg
gccgtgtgcgtcgacggctgcgaatacgactacctcgaagaagccgcgagcgcgggcgtc
gcgccgttcctcgcgcggatgctgcgcgagggctcggcgttcgaggccgactgcgtgatc
ccgtcgttcaccaacccgaacaacctatcgatcgtgtgcggcgcgccgccgtcggtgcac
ggcatttgcgggaacttcttctgggaccagaacgcgcagggcggcgcgggcgccgcggtg
atgatgaacgatcccgcctacctgcgcgcgggcacgctgctggcggccgcggcggatgcg
ggcgcgaaggtcgccgtcgtgacggcgaaggacaagctgcgccggctgctcggctggcgc
atgcgcggcgtgtgcttctcggcggagaaggcgaaccaggcgaatctcggcgagaacggc
atcgccgacgtgctcgacttcgtcggcctgccgtcgcccgacgtctacagcgcggcgctg
tcggagttcgtgctcgcggcgggcgtgcggctcgcgcagagccggcgcgcggacctgatg
tacctgtcgacgaccgattacgtgcagcacaaatgcgcgccgggcagcgagggcgcgaac
gcgttctacgcgatgatggaccgctacctcgcggcgctcgacgcgctcggctgggtgatc
ggcgtgaccgcggaccacgggatgaacgcgaagcacgatccgcgaaccggcgagccgaac
gtcgtctatctgcaggacgcgctcgacgcatggctcgggccgcgcctcgcacgcgtgatc
ctgccgatcaccgatccttacgtcgtccaccacggcgcgctcggctcgttcgcgacgatc
tacgtcgagcaaggcgtcgacgcgggcacggtgatcggccggctgcgcgagttcgacggc
gtcgagctcgcgctcgacaacgcgacggccgccgagcgcttcgagctgccggccgaccgg
atcggcgacgtcgtcgtcgtgggccggcgcgacgtcgtgctcggcacgcgcgcgcgcgag
cacgatctgtcgggcttgacggtgccgctgcgctcgcacggcggcctgtccgagcagcgc
gtgccgctgctgttcaaccgccggatcgagcacgtcgagccgggtcgccggctgcgcaac
ttcgatctgttcgacctcgcgctgaaccggaccgtgcaatga

DBGET integrated database retrieval system