KEGG   Burkholderia mallei FMH 23344: DM51_4554
Entry
DM51_4554         CDS       T03523                                 

Gene name
phnY
Definition
(GenBank) putative phosphonoacetaldehyde dehydrogenase
  KO
K00206  phosphonoacetaldehyde dehydrogenase [EC:1.2.1.-]
Organism
bmaf  Burkholderia mallei FMH 23344
Pathway
bmaf00440  Phosphonate and phosphinate metabolism
bmaf01100  Metabolic pathways
bmaf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmaf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    DM51_4554 (phnY)
Enzymes [BR:bmaf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     DM51_4554 (phnY)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: AIP73972
UniProt: A0A3N4G760
LinkDB
Position
2:1623223..1624677
AA seq 484 aa
MTTMPLRDHAAYRRETLRWCGQRAARARTLDVFDPYSGLRVGTVPLATVDDVRRAFDYAV
AYRPALSRYERSQILERAAARLTARAEEASTLISLESGLSKQDSRYEIGRVADVFKFASI
EALRDDAQSYSCDLTPHGKSRRVFSQRQPLDGVIVAITPFNHPMNQVAHKIAPAIATNNR
VIVKPSEKVPLSALYLADVLYEAGLPEPMLQVLTGDPREIADELLTHPSATLITFTGGVA
IGKSIAAKAGYRRIVLELGGNDPLIVLDDADLERAAALAAQGSYKNSGQRCTAVKRILVH
KRVAPRFTELLVEHTRAWTYGDPFDPANRMGTVIDEAAAALFEARVDEAVAQGARLLTGN
ARRGALYAPTVLDRVDASMTLVREETFGPVSPIIAFDTIDDAIRISNGTAFGLSSGVCTD
RADAIVRFVNELNVGTVNVWEVPGYRLELTPFGGIKDSGLGYKEGVQEAMKSFTNLKTFS
LPWA
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgacgacgatgccgcttcgcgatcacgccgcctaccgccgcgagacgctgcgctggtgc
gggcaacgggcggcgcgtgcgcgcacgctcgacgtattcgatccgtattcggggctgcgc
gtcggcaccgtgccgctcgcgacggtcgacgacgtgcgccgcgcgttcgactatgcggtc
gcgtaccggcctgcgctgtcgcgctacgagcgctcgcagatcctcgagcgcgcggccgca
cgcctcaccgcgcgcgcggaagaggcgtcgacgctgatctcgctcgaatcggggctgtcg
aaacaggattcgcgctacgagatcggccgcgtcgccgacgtgttcaagttcgcgtcgatc
gaggcgctgcgcgacgatgcgcagagctactcgtgcgatctgacgccgcacggcaagtcg
cgccgcgtgttctcgcagcgccagccgctcgacggcgtgatcgtcgcgatcacgccgttc
aatcatccgatgaaccaggtcgcgcacaagatcgcgccggcgatcgcgacgaacaaccgc
gtgatcgtgaaaccgtcggagaaggtgccgctgtcggcgctgtatctcgccgacgtgctg
tacgaagcgggcctgcccgagccgatgctgcaggtgctgacgggcgatccgcgcgagatc
gccgacgaactgctcacgcacccgagcgcgacgctgatcacgttcacgggcggcgtcgcg
atcggcaagtccatcgcggcgaaggcgggctaccggcgcatcgtgctcgagctgggcggc
aacgatccgctgatcgtgctcgacgatgccgatctcgaacgcgcggccgcgctcgccgcg
cagggctcgtacaagaactccggccagcgctgcacggcggtcaagcgcatcctcgtgcac
aagcgcgtcgcgccgcgcttcacggagctgctcgtcgagcacacgcgcgcatggacgtac
ggcgatccgttcgacccggcgaaccggatgggcaccgtgatcgacgaggcggcggccgcg
ctgttcgaggcgcgcgtcgacgaagcggtggcgcagggcgcgcgcctgctgacgggcaac
gcgcggcgcggcgcgctgtatgcgccgacagtgctcgatcgcgtcgacgcatcgatgacg
ctcgtgcgcgaggagacgttcggccccgtgtcgccgatcatcgcgttcgatacgatcgac
gacgcgatccgcatcagcaacggcaccgcgttcggcctgtcgtcgggcgtgtgcacggat
cgcgccgacgcgatcgtgcgcttcgtcaacgagctgaacgtcggcacggtgaacgtatgg
gaagtgccgggctaccggctcgagctcacgccgttcggcggcatcaaggattccgggctc
ggatacaaggaaggggtgcaggaggcgatgaagagcttcacgaacctgaagacgttttct
ttgccgtgggcgtga

DBGET integrated database retrieval system