KEGG   Burkholderia mallei FMH 23344: DM51_462Help
Entry
DM51_462          CDS       T03523                                 

Definition
(GenBank) cobalamin-5-phosphate synthase family protein
  KO
K02233  adenosylcobinamide-GDP ribazoletransferase [EC:2.7.8.26]
Organism
bmaf  Burkholderia mallei FMH 23344
Pathway
bmaf00860  Porphyrin and chlorophyll metabolism
bmaf01100  Metabolic pathways
Module
bmaf_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:bmaf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DM51_462
Enzymes [BR:bmaf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.26  adenosylcobinamide-GDP ribazoletransferase
     DM51_462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CobS
Motif
Other DBs
NCBI-ProteinID: AIP76942
UniProt: A0A3N4G6D5
LinkDB All DBs
Position
1:505415..506173
Genome map
AA seq 252 aa AA seqDB search
MNPLAELRYFVVALGYFTRVPVPRAISGQAVDLAHAARYFPLVGVCVGALAAAVHLAASR
VWPPGVAALASIAATLVATGALHEDGLADSCDAFGGGYTREDVLRIMRDSRIGTFGAAAL
VVALALKWQALAAMPPARAAWTMIAAHAASRTLAASLLLTLDYARAEGKAQPVAHRMRAG
AFAFAAALGLPWLFWPDWRAGALALAAMLVLRAGIARYLDARIGGYTGDCLGFAQQVFEL
SIYLAMLGWMSS
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgctcgccgaactgcgctacttcgtcgtcgcgctcgggtacttcacgcgcgtg
ccggtgccgcgcgcgatcagcggccaggccgtcgatctcgcgcatgcggcgcgctacttt
ccgctcgtcggcgtgtgcgtcggcgcgctcgccgcggccgtgcatctcgccgcgtcgcgc
gtgtggccgccgggcgtcgcggcgctcgcgtcgatcgcggcgacgctcgtcgccacgggc
gcgctgcacgaagacggcctcgccgacagttgcgacgcgttcggcggcggctacacgcgc
gaggacgtgctgcggatcatgcgcgattcgcgcatcggcacgttcggcgcggcggcgctc
gtcgtcgcgctggcgctgaagtggcaggcgctcgccgcgatgccgcccgcgcgcgcggcg
tggacgatgatcgccgcgcatgcggcgagccgcacgcttgccgcgagcctgcttctcacg
ctcgactatgcgcgcgccgaaggcaaggcgcagccggtcgcgcaccggatgcgcgcaggc
gcattcgcgttcgcggcggcgctcggcctgccgtggctgttctggccggactggcgcgcg
ggcgcgctcgcgctcgcggcgatgctcgtgctgcgcgccggcatcgcgcgttatctcgac
gcgcgcatcggcggctataccggcgattgtctcggcttcgcgcagcaggtgttcgagctg
tcgatctatctggcgatgctcggatggatgtcgtcctga

DBGET integrated database retrieval system