KEGG   Burkholderia mallei 2000031063: DM57_07165
Entry
DM57_07165        CDS       T03522                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bmai  Burkholderia mallei 2000031063
Pathway
bmai00440  Phosphonate and phosphinate metabolism
bmai00998  Biosynthesis of various secondary metabolites - part 2
bmai01100  Metabolic pathways
bmai01110  Biosynthesis of secondary metabolites
bmai01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmai00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    DM57_07165
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    DM57_07165
Enzymes [BR:bmai01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     DM57_07165
SSDB
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD L27
Other DBs
NCBI-ProteinID: AIW47831
UniProt: A0A3N4G8S4
LinkDB
Position
2:complement(488299..489987)
AA seq 562 aa
MNAREPNFTESRSARLRRMLTSPSLEFLMEAHNGLSARIVREAGFKDIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAQAGADAILIHSKLSRPDEILQFAREWSGRAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQAVAREIQDSETLVNVEERVASVNEIFRLQDADEYSAAERIYLSSS
ARASSAALVLAASRGNGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKKQGVNDITVVGGYR
ADAIDTSGVKLVVNERHAQTGELASLACAAERLTGDTIISYGDLLFRSYILRDLAESEAQ
FSVVVDSSQTQPSNQSVRDFAFCSAADDRGLFGQKAYLRRVSSDASEAAPHGRWIGLLNV
RGAGVARLKAMLGTLQARDDFDALDLPALLNALVDAGEQIEVQYVHGHWRGVNDLDDFRR
AGDFAHGQTPYAEQNAGSGSAR
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgaatgcacgcgaaccgaacttcaccgaatcgcgcagcgcgcggctgcggcggatgctg
acgagcccgtcgctcgaattcctgatggaggcgcacaacggcctgtccgcgcgcatcgtc
cgcgaggcgggcttcaaggacatctgggcgtcggggctcgcgatctccgcgcaattcggc
gtgcgcgacaacaacgaggcgagctggacacaggtggtcgacgtgctcgaattcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccggctcgtgagaaagctcgagcagcgcggcatcgccggcgtgtgcatcgaggac
aagcagtttccgaaaaccaacagcttcatcgacggcgagcgccagccgctcgccgagatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagagcgatccggatttctcg
atcgtcgcgcgcgtcgaggcgctgatcgccggctggggcatggacgaggcgctgcgccgc
gcgaacgcgtatgcgcaggccggcgccgatgcgatcctgatccacagcaagctgtcgcgc
ccggacgagatcctgcagttcgcgcgagaatggagcggccgcgcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggcgggcatcagcaccgtg
atctgggcgaaccatctgatccgcgcgtccgcttccgcgatgcaggcggtcgcccgcgaa
atccaggacagcgaaacgctcgtcaacgtcgaggaacgcgtggcgagcgtcaacgagatc
ttccggctgcaggacgccgacgaatactcggccgccgagcgcatctacctgtcgtcgagc
gcgcgcgcgtcgagcgcggcgctcgtgctcgccgcgagccgcggcaacgggctcgaggcc
gtcaccgaggacaagccgaaggtgatgctgccggtcgccggcaagccgctgttgcgctgg
ctcgtcgacggcttcaagaagcagggcgtgaacgacatcacggtcgtcggcggctaccgc
gccgatgcgatcgacacgtccggcgtgaagctcgtcgtcaacgagcggcacgcgcaaacg
ggcgagctcgcgtcgctcgcctgcgcggccgagcgtctgacgggcgacaccatcatctcg
tacggcgatctgctgtttcgcagctacatcctgcgcgacctcgcggaaagcgaggcgcag
ttcagcgtcgtcgtcgattcgtcgcagacgcagccgtcgaaccagagcgtgcgcgatttc
gcattctgctcggccgccgacgaccgcgggctgttcggccagaaagcgtacctgcgccgc
gtgtcgagcgacgcgagcgaggccgcgccgcacgggcgctggatcggcctgctgaacgtg
cgcggcgcgggcgtcgcgcggctgaaggcgatgctcggtacgctccaggcgcgcgacgat
ttcgatgcgctcgacctgccggcgctgctgaacgcgctcgtcgacgcgggcgagcagatc
gaagtgcagtacgtgcacggccattggcgcggcgtcaacgatctcgacgacttccgccgc
gcgggcgacttcgcgcacggccagacgccgtacgcggagcagaacgcgggcagcgggagc
gcacgatga

DBGET integrated database retrieval system