KEGG   Burkholderia mallei 2000031063: DM57_08470Help
Entry
DM57_08470        CDS       T03522                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bmai  Burkholderia mallei 2000031063
Pathway
bmai00250  Alanine, aspartate and glutamate metabolism
bmai00410  beta-Alanine metabolism
bmai00640  Propanoate metabolism
bmai00650  Butanoate metabolism
bmai01100  Metabolic pathways
bmai01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    DM57_08470
   00650 Butanoate metabolism
    DM57_08470
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DM57_08470
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DM57_08470
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bmai01007]
    DM57_08470
Enzymes [BR:bmai01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     DM57_08470
Amino acid related enzymes [BR:bmai01007]
 Aminotransferase (transaminase)
  Class III
   DM57_08470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIW48056
UniProt: A0A381DQI9
LinkDB All DBs
Position
2:complement(797630..798913)
Genome map
AA seq 427 aa AA seqDB search
MNNADLHARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRHPR
IVKAIADQLGQFTHTAYQIVPYASYVELAEKINARAPIAQPKKTAFFTTGAEAVENAVKI
ARAYTGRPGVIAFAGGFHGRTMMGMALTGKVAPYKIGFGPFPGDVFHAPYPNALHGVTSA
DSIAAVETLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVRALRKLCDAHGILLIADEV
QTGFARTGKLFAMEHYDVSADLMTIAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVAAAHAVLDVIDEEKLAERATVLGDKLKAKLAALRAELPQIVDVRGPGAMVAAEFVD
PHTRASDAAFTKRVQTLALERGLLLLICGVDANVIRFLFPLTIEDAVFDEALGILESVLR
EAVGVPA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaatgccgatctgcacgcccgcaagaacgccgcgacgccgcgtggcgtcggcgtg
atgtgcgatttctacgccgcgcgcgccgagaacgccgagctgtgggatgtcgagggccgc
cgcttcatcgatttcgcggccggcatcgcggtcctgaacacgggccatcgccatccgagg
atcgtgaaggcgatcgccgaccagctcgggcaattcacgcataccgcgtatcagatcgtg
ccgtacgcgtcgtacgtcgaactcgccgagaagatcaacgcgcgcgcgccgatcgcgcag
ccgaagaagaccgcgttcttcacgacgggcgcggaagcggtcgagaacgcggtgaagatc
gcgcgcgcctacaccggccggccgggcgtgatcgcgttcgcgggcggcttccacggccgc
acgatgatgggcatggcgctcaccggcaaggtcgcgccgtacaagatcggcttcggcccg
ttcccgggcgacgtgttccacgcgccgtacccgaacgcgttgcacggcgtgacgagcgcc
gattcgatcgcggccgtcgaaacgctgttcaaggccgacatcgatccgaagcgcgtcgcc
gcgatcatcttcgagccggtgcagggcgaaggcggcttcaacccggcgcccgccgagttc
gtgcgcgcgctgcgcaagctgtgcgacgcgcacggcattctcctcatcgccgacgaagtg
cagacgggcttcgcgcgcacgggcaagctgttcgcgatggagcactacgacgtctcggcc
gacctgatgacgatcgcgaagagcctcgcgggcgggatgccgctgtcgggcgtcgtcggc
cgcgcggacgtgatggacgcggccgcgccgggcggcctgggcggcacgtacgcgggcaat
ccgctcgccgtggccgccgcgcacgcggtgctcgacgtgatcgacgaggagaagctcgcc
gagcgcgcgaccgtgctcggcgacaagctgaaggcgaagctcgccgcgctgcgcgccgag
ctgccgcagatcgtcgacgtgcgcggcccgggcgcgatggtcgccgcggaattcgtcgat
ccgcacacgcgcgcgtccgatgccgcgttcacgaagcgcgtgcagacgctcgcgctcgag
cgcgggctgctgctgctcatctgcggcgtcgacgcgaacgtgatacgtttcctgtttcct
ctcaccatcgaggatgccgtgttcgacgaagcgctcggcattctcgagagcgtgctgagg
gaagcggtgggcgtgcccgcctga

DBGET integrated database retrieval system