KEGG   Burkholderia mallei 2000031063: DM57_1047Help
Entry
DM57_1047         CDS       T03522                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bmai  Burkholderia mallei 2000031063
Brite
Enzymes [BR:bmai01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DM57_1047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIO80736
UniProt: A0A290YBC6
LinkDB All DBs
Position
1:2340980..2341558
Genome map
AA seq 192 aa AA seqDB search
MAHTLPPLPYAEDALAPHISQETIQFHYGKHHQAYVTNLNNLIPGTEFENLPLEEIVKKS
SGGIFNNAAQIWNHTFFWNSLSPNGGGAPTGALGDAINAKWGSFDAFKEAFTKAAVGTFG
SGWAWLVKKADGSLDIVSTSNAATPLTTADKPLVTIDVWEHAYYIDYRNARPKFVEAFWN
IVNWDFAAKNFA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggctcatacgctcccgccgctgccgtacgctgaagacgccctcgctccgcatatctcg
caggagacgatccagtttcactacggcaagcatcaccaggcttatgtgacgaacctgaac
aacctgatccccggcaccgagttcgagaacctgccgctggaagagatcgtgaagaagtcg
tcgggcggcatcttcaacaacgccgcgcagatctggaatcacacgttcttctggaacagc
ctgtcgccgaacggcggcggcgcgccgacgggcgcgctcggcgacgcgatcaacgcgaag
tggggttcgttcgacgcgttcaaggaggcgttcacgaaggcagcggtcggcacgttcggc
tcgggctgggcttggctcgtgaagaaggcggacggctcgctcgacatcgtgtcgacgagc
aatgcggccacgccgctcacgacggccgacaagccgctcgtcacgatcgacgtgtgggaa
cacgcttactacatcgattaccgcaacgcgcgcccgaagttcgtcgaagcgttctggaac
atcgtgaactgggacttcgccgcgaagaacttcgcgtaa

DBGET integrated database retrieval system