KEGG   Burkholderia mallei 2000031063: DM57_1436Help
Entry
DM57_1436         CDS       T03522                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
bmai  Burkholderia mallei 2000031063
Pathway
bmai00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bmai01100  Metabolic pathways
bmai01110  Biosynthesis of secondary metabolites
bmai01130  Biosynthesis of antibiotics
bmai01230  Biosynthesis of amino acids
Module
bmai_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bmai00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DM57_1436
Enzymes [BR:bmai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     DM57_1436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI FtsK_gamma AAA_18
Motif
Other DBs
NCBI-ProteinID: AIO81017
LinkDB All DBs
Position
1:complement(1930422..1930910)
Genome map
AA seq 162 aa AA seqDB search
MGRAVARRLDRPFFDSDHEIEARTGARIPVIFELEGEAGFRDREAQMIAELTQRENIVLA
TGGGAILRPENRKLLHERGLVVYLRANPHDLWLRTRKDKNRPLLQTDDPKAKLEALYEAR
DPLYRECAHFVIETGRPSVNGLVNMVLMQLEMAGIVAKPLQA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
gtgggccgggcggtcgcgcgccggctcgacagacccttcttcgattcggatcacgagatc
gaggcgcgcaccggcgcgcgcattccggtcatcttcgaactcgagggcgaagcgggcttc
cgtgaccgcgaggcgcagatgatcgccgagctcacgcagcgcgagaacatcgtgctggcg
acgggcggcggcgcgatcctgcgccccgagaaccgcaagctgcttcacgaacggggcctc
gtcgtctatctgcgcgcgaatccgcacgatctctggctgcgcacccgcaaggacaagaat
cgcccgctgttgcagaccgacgatccgaaagccaagctcgaagcgctgtacgaagcgcgc
gatccgctctaccgcgaatgcgcgcacttcgtcatcgaaaccgggcggccgtccgtcaac
gggctcgtcaacatggtgctgatgcagctcgaaatggcgggcatcgtcgccaagccactc
caagcatga

DBGET integrated database retrieval system