KEGG   Burkholderia mallei 2000031063: DM57_1451Help
Entry
DM57_1451         CDS       T03522                                 

Definition
(GenBank) cytochrome C biogenesis protein CcdA
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
bmai  Burkholderia mallei 2000031063
Pathway
bmai00730  Thiamine metabolism
bmai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmai00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    DM57_1451
Enzymes [BR:bmai01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     DM57_1451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 3HCDH_N ApbA Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AIO79585
UniProt: A0A3B0EH72
LinkDB All DBs
Position
1:complement(1908428..1909561)
Genome map
AA seq 377 aa AA seqDB search
MNMRASESDFAVLGGGLVGRLIAWRLAGAGYRVSLYERGDAAGSGSAAWVAAAMLAPLAE
AASAERLITDLGVASFDLWPSWLAELPEPVYFQRNGTLVVWHHADRAEAPLFERRVRANA
SAELLDGGLIALAGAQLDAAEPALAGRFARGLLLPREGQLDNRQALRALAAGLAERGVDV
HWNAAVAPDAAPAARITIDCRGLGAKAQMPALRGIRGEVARVHAPGIGLTRPVRLLHPRY
PLYVAPKENDLYVIGATEIEGEDMSPVSVRSALELLSAAFSVHPAFGEARILELNTQCRP
TLPDHRPALVWDGGATLAVNGLYRHGFMIAPEIADAAARFAQALVERTVKDADTFAAWRR
DARWPALLQQRAAHASA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgcgtgcgtctgaatccgatttcgcggtgctgggcggcggcctcgtcggccgc
ctgatcgcgtggcgcctcgcgggcgcgggataccgcgtgtcgctctacgagcgcggcgac
gcggcgggctcgggctcggccgcatgggtcgcggccgcgatgctcgcgccgctcgccgaa
gccgcgagcgccgagcgcctcatcaccgatctcggcgtcgcgtcgttcgatctgtggccg
agctggcttgccgagctgccggagcccgtctacttccagcgcaacggcacgcttgtcgtc
tggcatcacgcggaccgcgcggaagcgccgctcttcgagcgccgcgtgcgcgcgaacgcg
agcgccgagctgctcgacggcggcctcatcgcgctcgcgggcgcgcagctcgacgcggcc
gagccggcgctcgccggccgcttcgcgcgcggcctgctgctgccgcgcgaaggccagctc
gacaatcgccaggcgctgcgcgcgctcgccgcgggcttggccgagcgcggtgtcgacgtg
cactggaatgccgccgtcgcgcccgacgccgcgcccgccgcgcgcatcacgatcgactgc
cgcgggctcggcgcgaaggcgcagatgccggcgctgcgcgggattcgcggcgaagtcgcg
cgcgtgcacgcgcccggcatcggcctcacgcgccccgtgcgactcttgcatccgcgctat
ccgctgtacgtcgcgccgaaggagaacgatctctacgtgatcggcgcgaccgagatcgag
ggcgaggacatgtcgcccgtcagcgtgcgctccgcgctcgaattgctgagcgccgcgttc
tccgtgcacccggcgttcggcgaggcgcgtattcttgaactgaacacgcaatgccggccg
acgctgcccgaccatcgtccggcgctcgtgtgggacggcggcgcgacgctcgcggtcaac
ggcctgtaccggcacggcttcatgatcgcgccggaaatcgccgatgccgcggcccgtttc
gcgcaggcgctcgtcgagcgtaccgtgaaggatgccgatacgttcgccgcgtggcggcgc
gacgcgcgctggccggcgctgctgcagcagcgcgcggcgcacgcgtccgcgtga

DBGET integrated database retrieval system