KEGG   Burkholderia mallei 2000031063: DM57_1670Help
Entry
DM57_1670         CDS       T03522                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bmai  Burkholderia mallei 2000031063
Pathway
bmai00010  Glycolysis / Gluconeogenesis
bmai00620  Pyruvate metabolism
bmai01100  Metabolic pathways
bmai01110  Biosynthesis of secondary metabolites
bmai01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DM57_1670
   00620 Pyruvate metabolism
    DM57_1670
Enzymes [BR:bmai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     DM57_1670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIO81648
UniProt: A0A381BI84
LinkDB All DBs
Position
1:complement(1680835..1682355)
Genome map
AA seq 506 aa AA seqDB search
MNHADMQHLNIEFPYRKQYGNFIGGEWVAPVGGEYFDNVSPVTGRPFTAIPRSREADIEL
ALDAAHAAKAGWAAKGAAERANVLLRIADRMEANLTRLAVAETIDNGKPLRETTAADVPL
AIDHFRYFAGCIRAQEGSIADIGGDMVAYHFHEPLGVVGQIIPWNFPLLMAAWKLAPALA
AGNCVVLKPAEQTPASILVFAELIQDLLPPGVLNIVNGFGLEAGKPLASSKRIAKIAFTG
ETSTGRLIMQYASENLIPVTLELGGKSPNIFFADVMDRDDSYFDKALEGFAMFALNQGEV
CTCPSRALVEESIYDRFIERALKRVEAIKQGHPLDSQTMIGAQASAEQLEKILSYIDIGR
GEGAQCLTGGERNVLGGELAEGYYVKPTVFRGHNKMRIFQEEIFGPVLAVTTFKTEEEAL
EIANDTLYGLGAGVWTRDGNRAYRFGRGIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRET
HKMMLDHYQQTKNLLVSYSEKPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgcggacatgcaacatctgaacatcgaattcccgtaccgcaagcagtacggg
aatttcatcggcggcgaatgggtcgccccggtcggcggcgagtatttcgacaacgtctcg
cccgtcaccggccggccgttcaccgcgatccctcgctcgcgcgaagccgacatcgagctc
gcgctcgacgccgctcacgcggccaaggcgggctgggccgcgaagggcgcggccgagcgc
gcgaacgtgctgctgaggatcgccgaccggatggaggcgaacctcacgcgcctcgccgtc
gccgagacgatcgacaacggcaagccgctgcgcgaaaccaccgcagccgacgtgccgctc
gcgatcgaccacttccgctacttcgcgggctgcatccgcgcgcaggaaggctcgatcgcc
gatatcggcggcgacatggtggcctaccacttccacgagccgctcggcgtcgtcggccag
atcatcccgtggaacttcccgctgctgatggccgcgtggaagctcgcgccggcgctcgcg
gccggcaactgcgtcgtgctcaagccggccgagcagacgcccgcgtcgatcctcgtgttc
gccgagctgatccaggatctgctgccgcccggcgtgctcaacatcgtcaacggcttcggc
ctcgaggccggcaagccgctcgcgtcgagcaagcggatcgcgaagatcgcgttcacgggc
gagacgtcgacgggccgcctcatcatgcagtacgcgagcgagaacctgattcccgtcacg
ctcgagctgggcggcaagagcccgaatattttcttcgccgacgtgatggatcgcgacgac
agctacttcgacaaggcgctcgaaggcttcgcgatgttcgcgctgaaccagggcgaagtc
tgcacgtgcccatcgcgcgcgctcgtcgaggagagcatctacgatcgcttcatcgaacgc
gcgctcaagcgcgtcgaggcgatcaagcagggccatccgctcgattcgcagacgatgatc
ggcgcgcaggcgtcggccgagcagctcgagaagatcctgtcgtacatcgacatcggccgc
ggcgaaggcgcgcaatgcctgacgggcggcgagcgcaacgtgctcggcggcgagctcgcc
gaaggctattacgtgaagccgaccgtgttccgcggccacaacaagatgcgcatcttccag
gaagaaatcttcgggccggtgctcgcggtgacgacgttcaagaccgaggaggaagcgctc
gagatcgcgaacgacacgctgtacggcctgggcgccggcgtctggacgcgcgacggcaac
cgcgcgtaccgcttcggccgcggcatccaggcgggccgcgtgtggacgaactgctatcac
gcgtatccggcgcacgcggcgttcggcggctacaagcaatccggcatcggccgcgagacg
cacaagatgatgctcgaccactaccagcagacgaagaacctgctcgtcagctacagcgaa
aagccgctcgggttcttctga

DBGET integrated database retrieval system