KEGG   Burkholderia mallei 2000031063: DM57_2065Help
Entry
DM57_2065         CDS       T03522                                 

Gene name
gatB
Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
bmai  Burkholderia mallei 2000031063
Pathway
bmai00970  Aminoacyl-tRNA biosynthesis
bmai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmai00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DM57_2065 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bmai03029]
    DM57_2065 (gatB)
Enzymes [BR:bmai01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     DM57_2065 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     DM57_2065 (gatB)
Mitochondrial biogenesis [BR:bmai03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DM57_2065 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey DUF3941
Motif
Other DBs
NCBI-ProteinID: AIO82099
UniProt: A0A3N4FLH0
LinkDB All DBs
Position
1:complement(1247779..1249251)
Genome map
AA seq 490 aa AA seqDB search
MTQWEVVIGLETHAQLSTVSKIFSGASTQFGAQPNTQACPVDLALPGVLPVLNRGAVERA
IRFGLAIGATVAPRSVFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKQA
YSKTVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKA
LHGLVMWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRAEIKNLNSFRFLEDAINYEVR
RQIELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGADWIARVK
GEMPELPAVMQQRFIEQYGVSAYDAGVLTSTKAMAEYFEALVAKAGAANAKLAANWLMGD
VSSQLNRDGIDIDACPVSAAQLALVLQRIADGTISNKIAKEIFVTIWDEKAADEGAADRI
IEAKGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKDKAFNALVGQAMKATKGKANPQQ
VNELLKKKLG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgacccagtgggaagtcgttatcggcctcgagacgcacgcgcagctgtcgaccgtctcg
aagatcttctcgggcgcgtcgacgcagttcggcgcgcaaccgaacacgcaggcgtgcccc
gtcgatctcgcgctgccgggcgtgctgcccgtgctgaaccgcggcgcggtcgagcgggcg
atccgcttcggcctcgcgatcggcgcgacggtggcgccgcgcagcgtcttcgcgcgcaag
aattacttctatccggatctgccgaagggctatcagatcagccagtacgagattccggtc
gtgcagggcggccagatcacgatccaggtgcccgccaacgaaaaggccggcaagcaggcg
tattcgaagacggtcaacctgacccgcgcgcacctcgaggaggacgcgggcaagtcgctg
cacgaggatttcgcggggatgacgggcatcgacctgaaccgcgcgggcacgccgctgctc
gagatcgtcaccgagccggaaatgcggagcgcggccgaggcggtcgcgtacgcgaaggcg
ctgcacggcctcgtcatgtggctcggcatctgcgacggcaacatgcaggaaggctcgttc
cgctgcgatgcgaacgtgtcggtgcgcccggtcggccaggagaagttcggcacgcgcgcc
gagatcaagaacctgaactcgttccgctttctcgaagacgcgatcaactatgaggtgcgt
cgccagatcgagctgatcgaggacggcggcgaagtcgtccaggaaacgcgtctgtacgac
ccggacaagcgcgagacgcgctcgatgcgcagcaaggaagacgcgcacgattaccgctat
ttccccgatccggacctgatgccgctcgtgatcggcgcggactggatcgcacgcgtgaag
ggcgagatgcccgagctgccggccgtgatgcagcagcgcttcatcgagcagtatggcgtg
tccgcgtacgacgcgggcgtgctgacgtcgacgaaggcgatggccgaatatttcgaggcg
ctggtcgcgaaggcgggcgcggcgaatgcgaagctcgccgcgaactggctgatgggcgac
gtgtcgtcgcaactgaaccgcgacggcatcgatatcgacgcgtgcccggtgtcggccgcg
cagctcgcgctcgtgctgcagcggatcgccgacggcacgatctcgaacaagatcgcgaag
gaaatcttcgtgacgatctgggacgagaaagcggccgacgaaggcgcggccgatcgcatc
atcgaagcgaagggcctgaagcagatctccgatacgggcgcgctcgaggcgatcatcgac
gaggtgctcgccgcgaacgcgaagtcggtcgaggaattccgcgcgggcaaggacaaggcg
ttcaacgcgctcgtcggccaggcgatgaaggcgacgaagggcaaggcgaatccgcagcag
gtcaacgagctcctgaagaagaagctcggctga

DBGET integrated database retrieval system