KEGG   Burkholderia mallei 2000031063: DM57_2892Help
Entry
DM57_2892         CDS       T03522                                 

Definition
(GenBank) alpha-amylase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bmai  Burkholderia mallei 2000031063
Pathway
bmai00500  Starch and sucrose metabolism
bmai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DM57_2892
Enzymes [BR:bmai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     DM57_2892
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     DM57_2892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap
Motif
Other DBs
NCBI-ProteinID: AIO80609
UniProt: A0A381BG05
LinkDB All DBs
Position
1:325630..329025
Genome map
AA seq 1131 aa AA seqDB search
MKPADTLEDVGRAQFVAHMARRPRRARRREAPGVADTPLWYKDAIIYQLHVKSFFDANND
GVGDFAGLIAKLDYIAELGVDTVWLLPFYPSPRRDDGYDIADYRGVHPDYGTLADVRRFI
REAHARGLRVITELVINHTSDQHPWFQRARRAKRGSVHRDYYVWSDTDLKYAGTRIIFLD
TETSNWTHDPVAGQYYWHRFYSHQPDLNFDNPAVVREVLQIMRFWLDLGIDGLRLDAVPY
LVEREGTSNENLPQTHAILKLIRATIDAEYPNRMLLAEANQWPEDVQEYFGDEDECHMAF
HFPLMPRIYMSIASEDRFPIIDIMRQTPALAPSNQWAVFLHNHDELTLEMVTDSERDLLW
QAYASERRARLNLGIRRRLAPLMERDRRRIELINSILLSMPGTPVIYYGDELGMGDNLHL
GDRDGVRTPMQWSSDRNGGFSRADPELLVLPPVMGTLYGYDAINVEAQTRDPHSLLNWTR
RILSTRRATRVFGRGAIRFLRPGNRKILAYLRELDGETPVLCVANLSRASQAVELDLSEF
AGCVPTEMTSDSPFPPIGQLPYLLTFPPYGFLWFALSEHGREPAWHQQYAEPLPEYLTLV
MRRGETQPGAALLDTLAQDALPSWLARRRWFASKERRVDSARFDALTPIPGEPFQYAEAR
VAVDGREERYVVPLASAWGSETPQPLFAQLALARVRRGHTVGLLTDAFALPSFAHGVLRQ
LRAGAAVPVAGGGRLEFRPEPDLARLDPGDAPGVRWFAAEQSNSSLVIGEAIVLKIVRKL
ATGVHPEAEMGRHLRRIGYRNVAPLVGEVVRIGADGAPHTVAILQEYVDNQGDAWTRSCD
FLKRAIEELALPAANDADAAAPSAEPEMIDGYATFAGIVGKRLGELHAALAQPSDDAAFA
PQRVSPARVDGWIGDALGWFERAASLLAERLDTLEGQTRAAAELLVAQRAAVAEALRALV
PRELDGCCIRIHGDFHLGQVLDVQGDALLIDFEGEPARPLGQRRAQSHPLRDVAGFLRSL
SYASAAAQFTIEKAPQQAAERKRALFERFGQAAADRFVAQYREALSAASREFVEPRYADR
LLALFLIEKASYELCYEAANRPDWLSVPANGLAALVARLIGGAAPQQEDAR
NT seq 3396 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccgcagacacgctcgaagacgtcggccgcgcgcagttcgtcgcgcacatggcc
cgaaggccgcgccgcgcgcgcaggcgagaagcgcccggcgtcgccgacacgccgctgtgg
tacaaggatgcgatcatctaccagttgcacgtgaagtcgttcttcgacgccaacaacgac
ggcgtcggcgatttcgccggcctgatcgcgaagctcgactacatcgcggagctcggcgtc
gacacggtgtggctgctgccgttctatccgtcgccgcgccgcgacgacggctacgacatc
gccgactaccgcggcgtgcatcccgactacggcacgctcgcggacgtgcgccgcttcatc
cgcgaggcgcacgcgcgcgggctgcgggtgatcaccgagctcgtgatcaaccacacgtcg
gatcagcatccgtggttccagcgcgcccggcgcgcgaagcgcggctccgtccaccgcgac
tactacgtgtggtccgacaccgatctcaagtacgcgggcacgcggatcatcttcctcgat
accgagacgtcgaactggacgcacgatccggtcgcgggccagtactactggcatcgcttc
tattcgcatcagcccgacctgaacttcgacaatccggccgtggtgcgcgaagtgctgcag
atcatgcgcttctggctcgatctcggcatcgacgggctgcggctcgacgcggtgccctac
ctcgtcgagcgcgagggcacgagcaacgagaacctgccgcagacgcacgcgatcctcaag
ctgatccgcgcgacgatcgacgccgagtacccgaaccggatgctgctcgccgaagcgaac
cagtggcccgaggacgtccaggaatatttcggcgacgaggacgagtgccacatggccttc
cacttcccgctgatgccgcgcatctacatgtcgatcgcgagcgaggaccgctttccgatc
atcgacatcatgcggcagacgcccgccctcgcgccgagcaatcaatgggcggtgttcctg
cacaaccacgacgagctcacgctcgagatggtcaccgattcggagcgcgacctgctctgg
caagcctacgcgagcgagcgccgcgcgcggctgaacctcggcatccgccgccggctcgcg
ccgctgatggagcgcgaccgccgcaggatcgagctgatcaactcgatcctgctgtcgatg
cccggcacgcccgtcatctactacggcgacgagctcggcatgggcgacaacctgcacctc
ggcgatcgcgacggcgtgcgcacgccgatgcaatggtcgtcggaccgcaacggcggcttc
tcgcgcgccgatcccgagctgctcgtgctgcctccggtgatgggcacgctgtacggctac
gacgcgatcaacgtcgaggcgcagacgcgcgatccgcattcgctgctgaactggacgcgg
cgcatcctgtcgacgcgccgcgcgacgcgcgtgttcggacgcggcgcgatccgcttcctg
cgcccgggcaaccgcaagatcctcgcgtatctgcgcgagctcgacggcgaaacgccggtg
ctctgcgtcgcgaacctgtcgcgcgcgtcgcaggcggtcgagctcgacctgtcggaattc
gccggctgcgtgccgaccgaaatgacgtcggactcgccgttcccgccgatcggccaactg
ccgtatctgctgacgttcccgccgtacggcttcctgtggttcgcgctgtccgagcacggc
cgcgagccggcctggcatcagcagtacgccgagccgctgcccgaatacctgacgctcgtg
atgcggcgcggcgagacgcagccgggcgccgcgctgctcgacacgctcgcgcaggacgcg
ctgccgtcatggctcgcgcggcggcgctggttcgcatcgaaggagcggcgcgtcgacagc
gcgcgcttcgacgcgctcacgccgattccgggcgagccgtttcagtatgcggaggcgcgc
gtcgccgtcgacggccgcgaagaacgctacgtggtgccgctcgcgagcgcctggggcagc
gagacgcctcagccgctgttcgcgcagctcgcgctcgcgcgcgtgcggcgcggccatacg
gtcggcctgctgaccgacgcgttcgcgctgccgtcgttcgcgcacggcgtgctgcgccag
ctgcgcgcgggcgcggccgtgccggtggcgggcggcgggcgtctcgaattccggcccgag
ccggacctggcgcggctcgatcccggcgatgcgcccggcgtgcggtggttcgccgccgag
cagagcaacagctcgctcgtgatcggcgaggcgatcgtgctgaagatcgtgcgcaagctc
gccacgggcgtccacccggaagcggagatgggccggcacctgcggcgcatcggctaccgg
aacgtcgcgccgctcgtcggcgaggtcgtgcgcatcggcgcggacggcgcgccgcacacc
gtcgcgatcctgcaggaatacgtcgacaatcagggcgacgcgtggacgcgctcgtgcgat
tttctcaagcgcgcgatcgaggagctcgcgctgcccgcggcaaacgacgccgacgcggcg
gcgccgagcgccgagccggagatgatcgacggctacgcgacgttcgcgggcatcgtcggc
aagcggctcggcgaactgcacgcggcgctcgcgcagccgagcgacgatgcggcgttcgcg
ccgcagcgcgtgtcgcccgcgcgcgtcgacggctggatcggcgatgcgctgggctggttc
gaacgcgcggcgagcctgctggccgaacggctcgacacgctcgaaggccaaacgcgcgcg
gccgccgagctgctcgtcgcgcagcgcgccgcggtggccgaggcgctgcgtgcgctggtg
ccgcgcgagctcgacggatgctgcatccggattcacggcgacttccacctgggccaggtg
ctcgacgtgcaaggcgacgcgcttctcatcgatttcgagggcgaacccgcgcgcccgctc
gggcagcgccgcgcgcaatcgcatccgttacgcgacgtggccgggttcctgcggtcgctg
tcgtacgcgagcgcggccgcgcagttcacgatcgaaaaggcgccgcagcaggccgccgag
cgcaagcgcgcgctgttcgagcgcttcgggcaggcggccgcggaccgcttcgtcgcgcaa
taccgcgaagcgctgtcggccgcgtcgcgcgaattcgtcgagccgcgctatgcggaccgg
ctgctcgcgctgttcctcatcgagaaggcgtcctacgagctgtgctacgaagccgcgaac
cggccggactggctgagcgtgcccgcaaacggcctcgccgcgctcgtcgcgcgcctgatc
ggcggcgccgcgccgcagcaggaggacgcgcgatga

DBGET integrated database retrieval system