KEGG   Burkholderia mallei 2000031063: DM57_605Help
Entry
DM57_605          CDS       T03522                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bmai  Burkholderia mallei 2000031063
Pathway
bmai00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bmai00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DM57_605
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmai02000]
    DM57_605
Enzymes [BR:bmai01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DM57_605
Transporters [BR:bmai02000]
 Other Transporters
  Pores ion channels [TC:1]
   DM57_605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AIO81679
UniProt: A0A381BEZ9
LinkDB All DBs
Position
1:2804649..2805305
Genome map
AA seq 218 aa AA seqDB search
MLRLCGFPVSNYYNKVKFVLLEHDIPFEASIVSVPIKDPAFLADTPLGKVPYLMTEHGSL
CESQAIIEYLAAIHPDKPIFPADPFAAAKAREITAVLELYLEWNVRELFPEAFFGGKVSD
GTKAHVEKRMPRALDGFKRLAKFSPYVLGDTFCIADIAAFIHLPVVALATKAIYGRDFVV
DAGIDWKAYVKRIEEARPAAKRVSDERKAFVAGLAKPG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggctttgtggttttccagtgtccaattattacaacaaggtcaagttcgtcctg
ctcgagcacgacattccgttcgaagcgtcgatcgtcagcgtcccgatcaaggaccccgcg
tttttggccgatacgccgctcggcaaggtgccgtatctgatgaccgagcacggctcgctg
tgcgaatcgcaggcgatcatcgaatatcttgccgcgattcatcccgacaagcccattttc
ccggccgatccgttcgcggcggcgaaggcgcgcgagatcacggcggtgctcgagctgtac
ctcgaatggaacgtgcgcgaactgtttccggaggcgttcttcggcggcaaggtgagcgac
ggcacgaaggcgcacgtcgagaagcgcatgccgcgcgcgctggacggtttcaagcggctc
gcgaaattttcgccgtacgtgctcggcgatacgttctgcattgccgacatcgccgcgttc
atccatctgccggtcgtcgcgctcgcgacgaaggcgatctacggccgcgatttcgtcgtc
gacgcggggatcgactggaaggcgtacgtgaagcgcatcgaggaagcgcggccggccgcg
aagcgcgtgagcgacgagcgcaaggcgttcgtcgcggggctcgcgaagccgggctga

DBGET integrated database retrieval system