KEGG   Burkholderia mallei 2000031063: DM57_818Help
Entry
DM57_818          CDS       T03522                                 

Definition
(GenBank) membrane protein
  KO
K07090  uncharacterized protein
Organism
bmai  Burkholderia mallei 2000031063
Brite
KEGG Orthology (KO) [BR:bmai00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    DM57_818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AIO80552
UniProt: A0A3N4FPE6
LinkDB All DBs
Position
1:complement(2576295..2577089)
Genome map
AA seq 264 aa AA seqDB search
MSLPHIDPLYSLSGLFVGFLVGLTGVGGGSLMTPILVLLFNVHPATAVGTDLLYAALTKA
TGTFVHGLKGTVEWRITGRLAAGSVPAAAITLWFLHAHGMHSQETSRMIQFVLGAALLLT
SLSLLLRPQLAAFAAKRTRALPPNPTRTLAATVLTGAVLGVLVSLTSVGAGAIGVTVLLL
LYPALSTTRIVGSDIAHAVPLTLVAGVGHWMLGSVDWAMLVSLLIGSVPGIVVGSHLSAR
APEGLLRRVLAATLVAVGAKLVLS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttgccccatatcgatccgctgtattccctgtccggcctcttcgtcggttttctc
gtcggcttgacgggcgtcggcggcggttcgctgatgacgccgatcctcgtgctgctgttc
aacgtccatccggcgacggcggtgggcaccgatctgctttacgcggcgctcaccaaagcg
acgggcaccttcgtgcacgggctcaagggcacggtcgaatggcggatcaccgggcgtctc
gcggcgggcagcgtgcccgccgccgcgatcacgctgtggttcctgcatgcgcacggcatg
cattcgcaggaaacgagccggatgatccagttcgtgctcggcgccgcattgctgctcacg
tcgctgtcgctgctgttgcgcccgcagctcgccgcgttcgccgcgaagcgcacgcgcgcg
ctgccgcccaacccgacgcgcacgctcgccgcgaccgtgctcacgggcgccgtgctcggc
gtgctcgtgtcgctgacctcggtcggcgcgggcgcgatcggcgtgacggtcctgctgctg
ctgtacccggcgctgtcgacgacgcgcatcgtcggctccgacatcgcgcacgcggtcccg
ctcacgctcgtcgcgggcgtcggacactggatgctcggctcggtcgactgggcgatgctg
gtgtcgctgctgatcggatcggtgcccggaatcgtcgtcggcagccatctgtcggcgcgc
gcgcccgaagggctgctgcgccgggtgctcgcggcgacgctcgtcgcggtcggcgcgaag
ctcgtgctgtcctga

DBGET integrated database retrieval system