KEGG   Burkholderia mallei 23344: DM55_1777Help
Entry
DM55_1777         CDS       T03323                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bmal  Burkholderia mallei 23344
Pathway
bmal00020  Citrate cycle (TCA cycle)
bmal00480  Glutathione metabolism
bmal01100  Metabolic pathways
bmal01110  Biosynthesis of secondary metabolites
bmal01120  Microbial metabolism in diverse environments
bmal01130  Biosynthesis of antibiotics
bmal01200  Carbon metabolism
bmal01210  2-Oxocarboxylic acid metabolism
bmal01230  Biosynthesis of amino acids
Module
bmal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmal_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bmal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DM55_1777 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DM55_1777 (icd)
Enzymes [BR:bmal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     DM55_1777 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIO52225
UniProt: A0A290Y709
LinkDB All DBs
Position
1:complement(1937882..1939141)
Genome map
AA seq 419 aa AA seqDB search
MPYQHIKVPEGGDKITVNKDFSLNVSDQPIIPYIEGDGTGFDITPVMIKVVDAAVEKAYG
GKKKIHWMEIYAGEKATKVYGPDVWLPEETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPIQYFKGVPSPVREPEKTNMVIFRENSEDIYAGIEWAAESEQAKKVIKF
LQEEMGVKKIRFPQTSGIGIKPVSKEGTERLVRKAIQYAIDNDRKSVTLVHKGNIMKFTE
GAFRDAGYALAQKEFGAELIDGGPWMKFKNPKTGNEIVVKDSIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADVIISAMEKSIKQKRVTYDFARLMEGATQVSCSGFGQVLIENME
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccggaaggcggtgacaagatcaccgtcaacaaggat
ttctcgctcaacgtttccgatcagccgatcatcccttacatcgagggcgacggcacgggc
ttcgacatcacgccggtgatgatcaaggtcgtcgacgcggcggtcgagaaggcgtacggc
ggcaagaagaagattcactggatggagatctacgccggcgagaaggcgacgaaggtctac
ggcccggacgtgtggctgccggaagagacgctgcaggtgctgaaggaatacgtcgtgtcg
atcaaggggccgctcacgaccccggtcggcggcggcatccgctcgctgaacgtcgcgctg
cgtcaggagctcgacctgtacgtctgcctgcgcccgatccagtacttcaagggcgtgcct
tcgcccgtgcgcgagccggagaaaaccaacatggtcatcttccgcgagaactcggaagac
atctacgccggcatcgaatgggcggccgaatccgagcaggcgaagaaggtcatcaagttc
ctgcaggaagagatgggcgtgaagaagatccgcttcccgcagacctcgggcatcggcatc
aagcccgtgtcgaaggaaggcaccgagcgcctcgtgcgcaaggcgatccagtacgcgatc
gacaacgaccgcaagtcggtcacgctcgtccacaagggcaacatcatgaagttcacggaa
ggtgcgttccgtgacgccggctatgcgctcgcgcagaaggaattcggcgccgagctgatc
gacggcggcccgtggatgaagttcaagaacccgaagacgggcaacgagatcgtggtcaag
gattcgatcgccgacgcgttcctgcagcagatcctgctgcgcccggccgaatacgacgtg
atcgcgacgctgaacctgaacggcgactacatctcggacgcgctcgccgcgcaagtcggc
ggcatcggcatcgcgccgggcgcgaacctgtcggattcggtcgcgatgttcgaagcgacg
cacggcacggcgccgaagtacgcgggcaaggattacgtgaacccgggttcggaaatcctg
tcggccgaaatgatgctacgccacctcggctggaccgaagcggccgacgtgatcatttcc
gcgatggagaagtcgatcaagcagaagcgcgtcacgtacgacttcgcgcgcctgatggaa
ggcgcgacgcaagtgtcgtgctcgggcttcggtcaggtgctgatcgaaaacatggagtaa

DBGET integrated database retrieval system