KEGG   Burkholderia mallei 23344: DM55_3902Help
Entry
DM55_3902         CDS       T03323                                 

Gene name
accC
Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
bmal  Burkholderia mallei 23344
Pathway
bmal00061  Fatty acid biosynthesis
bmal00620  Pyruvate metabolism
bmal00640  Propanoate metabolism
bmal01100  Metabolic pathways
bmal01110  Biosynthesis of secondary metabolites
bmal01120  Microbial metabolism in diverse environments
bmal01130  Biosynthesis of antibiotics
bmal01200  Carbon metabolism
bmal01212  Fatty acid metabolism
Module
bmal_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bmal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DM55_3902 (accC)
   00640 Propanoate metabolism
    DM55_3902 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DM55_3902 (accC)
Enzymes [BR:bmal01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     DM55_3902 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     DM55_3902 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 Oxidored_nitro LAL_C2 ATP-grasp_5 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AIO53908
UniProt: A0A3N4FID9
LinkDB All DBs
Position
2:complement(833839..835284)
Genome map
AA seq 481 aa AA seqDB search
MNDLDSTHASFYRPSRIGTVLVANRGEIAVRVIRAAHELGMRAVAAVSDADRDSLAARMA
DEAVHIGPSHAAKSYLDPAAMLAAAQQCGADAIHPGYGFLSENADFAAQVEAAGLIFVGP
PARVIATMGDKARARETARRAGVPTVPGSEGVVASLDGAHEVAARIGYPVMIKAAAGGGG
RGIRVAHDAAQLAAQLPLAQREAQAAFGDGGVYLERFIARARHIEVQILGDGENVIHLFE
RECSLQRRRQKILEEAPSPSLTPALRDALCASATRLARQVGYRGAGTLEYLFDDARGEFY
FIEMNTRIQVEHPVTEAVTGVDLVREMLRIADGEPLRFAQGDIALRGAALECRINAEDPL
QDFRPNPGRIDALVWPAGPGVRIDSLLYPGYTVPPFYDSLLAKLIVHDESRPAALARAAR
ALRELRIDGVKTTAPLHRALLDDADVRAGRYHTNYLEAWMRDWLARLDARASAPRGLGKA
A
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacctcgattcgacccacgcttcgttttaccggccgtcccggatcggtacggtg
ctcgtcgccaatcgcggcgagatcgcggtgcgcgtgattcgcgccgcgcacgagctcggg
atgcgcgcggtcgccgcggtcagcgacgcggaccgcgacagcctcgccgcgcggatggcc
gacgaagcggtgcacatcggcccgtcgcacgcggcgaagagctatctggatccggccgcg
atgctcgccgccgcgcagcaatgcggcgccgacgcgattcatccgggctacggctttctg
tcggagaacgcggacttcgccgcgcaggtcgaagccgccggcctgatcttcgtcggtccg
cccgcgcgcgtgatcgcgacgatgggcgacaaggcccgcgcgcgcgaaaccgcgcggcgc
gccggcgtgccgacggtgccgggcagcgaaggcgtcgtcgcgtcgctcgacggcgcgcac
gaggtggccgcgcgcatcggctacccggtgatgatcaaggcggccgcgggcggcggcggg
cgcggtatccgcgtcgcgcacgacgccgcgcagctcgccgcgcagctaccgctcgcgcag
cgcgaggcacaggccgcgttcggcgacggcggcgtctatctcgaacgcttcatcgcgcgc
gcgcggcacatcgaagtgcagatcctgggcgacggcgagaacgttattcatctgttcgaa
cgcgaatgctcgctgcagcggcggcgccagaagattctcgaggaagcgccgtctccgtcg
ctcacgcccgcgctgcgcgatgcgctgtgcgcatcggcgacgcgtctcgcgcggcaggtg
ggctatcgcggcgcgggcacgctcgagtatctgttcgacgacgcgcgcggcgagttctac
ttcatcgagatgaacacgcgcatccaggtcgagcatccggtgacggaggcggtcacgggc
gtcgatctcgtgcgcgagatgttgcgcatcgcggacggcgagccgctgcgcttcgcgcag
ggcgacatcgcactgcgcggcgccgcgctcgaatgccggatcaacgcggaggacccgctg
caggatttccggcccaaccccggccgcatcgatgcgctcgtctggcccgcgggccccggc
gttcgaatcgattcgctgctctatccgggctacacggtgccgccgttctacgattcgctg
ctcgcgaagctgatcgtgcacgacgaaagccggccggccgcgctcgcgcgcgcggcgcgc
gcgctgcgcgagctgcgcatcgacggcgtgaagaccaccgcgccgctgcatcgcgcgctg
ctcgacgacgccgacgtgcgcgcgggccgctatcacacgaactatctggaggcctggatg
cgcgactggctcgcgcggctcgacgcccgcgcgagcgcgccgcgtggcctgggaaaggca
gcatga

DBGET integrated database retrieval system