KEGG   Burkholderia mallei 23344: DM55_4432Help
Entry
DM55_4432         CDS       T03323                                 

Definition
(GenBank) short chain dehydrogenase family protein
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bmal  Burkholderia mallei 23344
Pathway
bmal00061  Fatty acid biosynthesis
bmal00780  Biotin metabolism
bmal01100  Metabolic pathways
bmal01130  Biosynthesis of antibiotics
bmal01212  Fatty acid metabolism
Module
bmal_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bmal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DM55_4432
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DM55_4432
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    DM55_4432
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bmal01004]
    DM55_4432
Enzymes [BR:bmal01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     DM55_4432
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     DM55_4432
Lipid biosynthesis proteins [BR:bmal01004]
 Fatty acid synthase
  Component type
   DM55_4432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AIO54762
UniProt: A0A3N4FLG6
LinkDB All DBs
Position
2:1472025..1472786
Genome map
AA seq 253 aa AA seqDB search
MRLQHKRGLIIGIANENSIAFGCARVMREQGAELALTYLNEKAEPYVRPLAQRLDSRLVV
PCDVREPGRLEDVFARIAQEWGQLDFVLHSIAYAPKEDLHRRVTDCSQAGFAMAMDVSCH
SFIRVARLAEPLMTNGGCLLTVTFYGAERAVEDYNLMGPVKAALEGSVRYLAAELGPRRI
RVHALSPGPLKTRAASGIDRFDALLERVRERTPGHRLVDIDDVGHVAAFLASDDAAALTG
NVEYIDGGYHVVG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgacttcagcacaagcgtggcctcatcatcggcattgcaaacgaaaacagcatcgcg
ttcggctgcgcgcgggtcatgcgcgagcagggcgccgagctcgcgctcacttacttgaac
gaaaaggccgagccctatgtccgtccgctcgcgcagcgtctggacagccggctcgtcgtg
ccgtgcgacgtgcgcgagcccggccggctcgaggacgtgttcgcgcgcatcgcgcaggaa
tgggggcagctcgacttcgtgctgcactcgatcgcatacgcgccgaaggaggacctgcat
cgccgcgtgaccgactgctcgcaggcgggcttcgcgatggcgatggacgtgtcgtgccat
tcgttcattcgcgtcgcgcgcctggccgagccgctgatgacgaacggcggctgcctgctg
accgtcacgttctacggtgccgagcgggctgtcgaggactacaacctgatgggcccggtg
aaggcggcgctcgagggctcggtgcgctatctcgccgccgagctcgggccgcggcgcatc
cgcgtgcacgcgctgtcgcccgggccgctgaagacgcgcgccgcgtccggcatcgaccgc
ttcgacgcgctgctcgaacgcgtgcgcgagcgcacgcccgggcatcgcctcgtcgacatc
gacgacgtcggccatgtcgccgcgttcctcgcgagcgacgatgcggccgcgctgacgggc
aacgtcgagtacatcgacggcggctatcacgtcgtcggctga

DBGET integrated database retrieval system