KEGG   Burkholderia mallei 23344: DM55_4540Help
Entry
DM55_4540         CDS       T03323                                 

Definition
(GenBank) 3-deoxy-7-phosphoheptulonate synthase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
bmal  Burkholderia mallei 23344
Pathway
bmal00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bmal01100  Metabolic pathways
bmal01110  Biosynthesis of secondary metabolites
bmal01130  Biosynthesis of antibiotics
bmal01230  Biosynthesis of amino acids
bmal02024  Quorum sensing
Module
bmal_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bmal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DM55_4540
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DM55_4540
Enzymes [BR:bmal01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     DM55_4540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AIO53520
UniProt: A0A3N4FF11
LinkDB All DBs
Position
2:complement(1602867..1603985)
Genome map
AA seq 372 aa AA seqDB search
MQNIDNPQRDRETGFADATQDTTRIDDVRIGAVRPLISPALLQDELPVPSAVQALVEASR
DAIGDVLHGRDDRLLAIVGPCSIHDHDQALDYARRLKSAADALRDDLLIVMRVYFEKPRT
TVGWKGYINDPRLDGSFRINEGLRAARRLLIDINALGLPAGTEFLDLLSPQYIADLIAWG
AIGARTTESQSHRQLASGLSCPIGFKNGTDGGVQVAADAIVAARASHAFMGMTKMGMAAI
FETRGNDAAHVILRGGKRGPNYDRASVDEACAVLRAAGQREQVMIDCSHANSNKSHLRQV
DVAEDLARQLSDGERRITGVMVESNLEAGRQDLKPGVPLQYGVSITDACLSWAQTEPVLD
TLAQAVRRRRAA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacatcgacaatccgcaacgcgatcgggaaaccggcttcgccgacgcgacgcag
gacacgacgcgcatcgacgacgtgcgcatcggcgcggtgcgcccgctcatctcgcccgcg
ctgctgcaggacgaactgccggtgccgagcgccgtccaggcgctcgtcgaagcgagccgc
gacgcgatcggcgacgtgctgcacggccgcgacgaccgcctgctcgcgatcgtcggcccg
tgctcgatccacgatcacgatcaggcgctcgactacgcgcgccggctgaaaagcgccgcc
gacgcgctgcgcgacgacctgctgatcgtgatgcgcgtgtatttcgagaagccgcgcacg
acggtcggctggaagggctacatcaacgatccgcgcctcgacggcagcttccgcatcaac
gaagggctgcgcgccgcgcgccggctgctgatcgacatcaacgcgctcggcctgcccgcc
ggcaccgaattcctcgatctgctgagcccgcagtacatcgcggatctgatcgcctggggc
gcgatcggcgcgcgcacgaccgagagccagagccaccggcagctcgcgtcggggctgagc
tgcccgatcggcttcaagaacggcaccgacggcggcgtgcaggtcgcggccgacgcgatc
gtcgcggcgcgcgcgagccacgcgttcatgggcatgacgaagatggggatggccgcgatt
ttcgagacgcgcggcaacgacgccgcgcacgtgatcctgcgcggcggcaagcggggcccg
aactacgatcgcgcgagcgtcgacgaggcgtgcgcggtgctgcgcgcggcgggccagcgc
gagcaggtgatgatcgactgctcgcacgcgaattcgaacaagtcgcacctgcggcaggtc
gacgtcgccgaggacctcgcgcgccagttgtcggacggcgagcgacgcatcaccggcgtg
atggtcgagagcaacctggaggccggccggcaggacctgaagcccggcgtgccgctgcaa
tacggcgtgtcgatcaccgacgcgtgcctgagctgggcgcagaccgagcccgtgctcgac
acgctcgcgcaggcggtgcggcggcggcgcgccgcctga

DBGET integrated database retrieval system