KEGG   Bombyx mandarina (wild silkworm): 114248823
Entry
114248823         CDS       T05882                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen
  KO
K16679  wengen
Organism
bman  Bombyx mandarina (wild silkworm)
Pathway
bman04013  MAPK signaling pathway - fly
bman04214  Apoptosis - fly
bman04215  Apoptosis - multiple species
bman04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:bman00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    114248823
   04391 Hippo signaling pathway - fly
    114248823
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    114248823
   04215 Apoptosis - multiple species
    114248823
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 114248823
NCBI-ProteinID: XP_028038038
UniProt: A0A6J2K8W0
LinkDB
Position
Unknown
AA seq 224 aa
MNIRAGVMQGDITKLCVLVATLALGKVWGGGLCERGRSFWDQKNQACTPCTHCDPTLRLV
VKYPCEVYRDTICQSIYELGIWPFESAQGDTKDNDVSDDEYYEYTDYDSEVSKDSDGEVT
WDLQTTSLTLAASGCVVFFLVVLVMSLYHAKQWKVIKRALKSDVQDLTAKLKLMESGGDA
PAEPVVTTDHHLYCNIHLGKEALLGTTPTKKGTGNVYTQEKHPS
NT seq 675 nt   +upstreamnt  +downstreamnt
atgaacataagggctggggtaatgcaaggagacataacaaagttatgtgtgctagtcgct
acactggcactgggcaaagtatggggcggaggtttgtgtgagcgggggcgtagcttttgg
gaccagaagaaccaggcctgcaccccgtgcacgcactgtgacccaaccctgcgcctcgtt
gtcaaatacccatgtgaagtgtaccgggataccatctgccagtccatctacgaactaggg
atatggcccttcgaaagcgctcagggtgatactaaagacaatgacgtcagtgatgacgaa
tactacgagtacacggattatgatagtgaagtgagtaaagatagcgatggtgaagtgacg
tgggacctacagactaccagtttgaccctggccgcgagtggatgtgtcgttttctttctc
gtggtgctagtaatgtcactgtaccatgccaagcaatggaaggtaataaaacgggcgctt
aaatcagatgttcaagacctcactgctaagctaaagctcatggagtccggtggagacgcg
cctgcggaacccgtagttactactgatcatcacttatactgtaatattcacttaggaaaa
gaagctctgcttggtacaacaccaaccaaaaaaggcacgggcaacgtgtacacacaagag
aagcatccgtcttga

DBGET integrated database retrieval system