KEGG   Bombyx mandarina (wild silkworm): 114252875
Entry
114252875         CDS       T05882                                 

Definition
(RefSeq) uncharacterized protein LOC114252875
  KO
K20017  Bcl-2 family protein
Organism
bman  Bombyx mandarina (wild silkworm)
Pathway
bman04214  Apoptosis - fly
bman04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:bman00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    114252875
   04215 Apoptosis - multiple species
    114252875
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 114252875
NCBI-ProteinID: XP_028043354
UniProt: A0A6J2KT51
LinkDB
Position
Unknown
AA seq 289 aa
MRRKLSTPLTSLTSVSDELPGLKISPSRSLSPLDRTKRRFSTMVTSAAAAAVTRRLSATI
GWYLASHTQVKPQIVRQGRALCLQYIKTQIRRSTTCVKKQIVMKRLQRMIETECGEEATC
NSDTGVLSALRALCAALERKRPEAFRHVARQATRAPSAMLRSDTALAELALALARRVTRE
NITWSKIAAVYCICGALAREAAEAAEGEPSLELITAPAAAIADVLHEEPGSWIASHGGWN
GLIDRLRASERDHTSEKNLRFMIGFFVMTFLTLLLFRWLLHTNPSYGDS
NT seq 870 nt   +upstreamnt  +downstreamnt
atgcgtcgaaagctcagcactccgcttacctcgctaaccagcgtttccgatgaattgcct
ggcttgaaaatttcaccaagtcgatctctttcgccgcttgaccgcaccaagcgacggttc
agcacaatggtgacgagcgcagccgctgcagctgtgactcgccgcctgtccgcaactata
ggatggtaccttgccagtcatacacaggtcaaaccgcagatcgtacgccaagggcgtgca
ctttgcctgcaatatattaaaacacagatacgaagatcaactacctgtgtcaaaaagcag
atagttatgaagcgccttcagcgtatgatcgagactgagtgtggagaagaggctacttgt
aatagtgacactggggtactttctgcactccgcgcgctatgtgcggcgttggagagaaag
cggccggaagcattccgtcatgtcgcgcgtcaagcaaccagggctccttcagctatgctg
cgctcagacactgcacttgcagaacttgcacttgcactcgcaagacgggtcacaagggag
aacatcacgtggtcaaagattgccgctgtatattgtatttgcggagcactggctagggaa
gctgctgaggcagcagaaggagagccatcattagagctaatcacagcaccggctgctgca
attgctgacgtcttacacgaggagcctggatcatggatcgcctctcatggaggatggaat
ggactaatagatcgtctgcgcgccagcgaacgtgatcatacatcggagaagaatttacgt
tttatgattggattcttcgtgatgaccttcttgacactgctgctgtttcgatggctttta
catactaacccaagttatggcgactcatag

DBGET integrated database retrieval system