KEGG   Burkholderia mallei BMQ: DM76_1257Help
Entry
DM76_1257         CDS       T03490                                 

Gene name
tuf
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bmaq  Burkholderia mallei BMQ
Brite
KEGG Orthology (KO) [BR:bmaq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bmaq03012]
    DM76_1257 (tuf)
   03029 Mitochondrial biogenesis [BR:bmaq03029]
    DM76_1257 (tuf)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmaq04147]
    DM76_1257 (tuf)
Translation factors [BR:bmaq03012]
 Eukaryotic Type
  Elongation factors
   DM76_1257 (tuf)
 Prokaryotic Type
   DM76_1257 (tuf)
Mitochondrial biogenesis [BR:bmaq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    DM76_1257 (tuf)
Exosome [BR:bmaq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DM76_1257 (tuf)
  Exosomal proteins of breast cancer cells
   DM76_1257 (tuf)
  Exosomal proteins of colorectal cancer cells
   DM76_1257 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AIO63429
UniProt: A0A0E1FXD0
LinkDB All DBs
Position
1:1365573..1366763
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSAKFGGEAKKYDEIDAAPEEKARG
ITINTAHIEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIIKGSAKLALE
GDKGELGEVAIMNLADALDTYIPTPERAVDGAFLMPVEDVFSISGRGTVVTGRVERGVIK
VGEEIEIVGIKATAKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLAKPGS
ITPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaaaagtttgagcggaccaagccgcacgtgaacgttggtacgattggtcac
gttgaccacggcaagacgacgctgacggcagcgatcgcgacggtgctgtcggcgaagttc
ggcggcgaagcgaagaagtacgacgaaatcgacgcggcgccggaagaaaaggcgcgcggc
atcacgatcaacaccgcgcacatcgagtacgaaacggcgaaccgccactacgcacacgtg
gactgcccgggccacgccgactacgtgaagaacatgatcacgggcgcggcgcagatggac
ggcgcgatcctggtgtgctcggccgctgacggcccgatgccgcaaacgcgtgagcacatc
ctgctggcgcgtcaggtcggtgtgccgtacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgcggagctgctcgagctggtcgaaatggaagtgcgcgaactgctgtcgaag
tacgacttcccgggcgacgacacgccgatcatcaagggttcggcgaagctggcgctggaa
ggcgacaagggcgagctgggcgaagtggcgatcatgaacctggccgacgcgctggacacg
tacatcccgacgccggagcgtgcggtcgacggcgcgttcctgatgccggtggaagacgtg
ttctcgatctcgggccgtggtacggtggtgacgggtcgtgtcgagcgcggcgtgatcaag
gttggcgaggaaatcgaaatcgtcggtatcaaggcgacggcgaagacgacctgcacgggc
gtggaaatgttccgcaagctgctggaccagggtcaggcgggcgacaacgtcggtatcctg
ctgcgcggcacgaagcgtgaagacgtggagcgcggccaggttctggcgaagccgggttcg
atcacgccgcacacgcacttcacggcagaagtgtacgtgctgagcaaggacgaaggcggc
cgccacacgccgttcttcaacaactaccgtccgcagttctacttccgtacgacggacgtg
acgggctcgatcgagctgccgaaggacaaggaaatggtgatgccgggcgacaacgtgtcg
atcacggtgaagctgatcgcgccgatcgcgatggaagaaggtctgcgcttcgcgatccgc
gaaggcggtcgcaccgtcggcgccggcgtcgtcgccaagatcatcgagtaa

DBGET integrated database retrieval system