KEGG   Burkholderia mallei BMQ: DM76_1619Help
Entry
DM76_1619         CDS       T03490                                 

Definition
(GenBank) FAD dependent oxidoreductase family protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bmaq  Burkholderia mallei BMQ
Pathway
bmaq00564  Glycerophospholipid metabolism
bmaq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmaq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DM76_1619
Enzymes [BR:bmaq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DM76_1619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_oxidored NAD_binding_8 3HCDH_N FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AIO62449
UniProt: A0A381BB90
LinkDB All DBs
Position
1:complement(1763522..1765054)
Genome map
AA seq 510 aa AA seqDB search
MTQQNRYDLLVVGGGINGAGIARDAAGRGLSVLLCEQDDLASHTSSSSTKLIHGGLRYLE
YKEFGLVRKALQERETLLRAAPHIMWPLRFVMPHMPNLRPAWLIRIGLFLYDHLAKRELL
PGSRGIDMRRHPAGAPLVDSIKRGFVYSDGWVDDARLVVLNALDAQERGARILTRTKLVS
AERRDGQWHARLQRADGSTLDVRARAIANAAGPWVGEVLHGALGRGAQHSVRLVKGSHII
TPRLFDHDHAYIFQNPDKRIIFAIPYERDFTLIGTTDVEYRDDPSRVAIDRDETRYLCES
INRYFKRKISPADVCWTYSGVRPLLEDENADNPSAVTRDYRLELDDGEGAPLLSVFGGKI
TTFRKLAEEATDMLGGALGAARGAWTAGVPLPGGDIANARFAPFAEAFAKRHPWLPAALA
RRYARAYGTRAERVIGRARSHAELGVQLAPGLYEAELRYLRDVEWAGCADDVLWRRSKLG
LHVAPGTLEPVTAALDAWFGAAREAASAAH
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
gtgactcaacagaatcgttacgatctgctcgtcgtcggcggcgggatcaacggcgcgggc
atcgcgcgcgatgcggccggccgcggcctgtcggtgctcctttgcgagcaggacgacctc
gcgtcgcacacctcctcttcgagcacgaagctgatccacggcgggttgcgctacctcgaa
tacaaggaattcgggctcgtgcgcaaggcgctgcaggaacgcgaaacgctgctgcgcgcg
gcgccgcacatcatgtggccgctgcgcttcgtgatgccgcacatgccgaacctgcgcccc
gcgtggctcatccggatcggcctcttcctgtacgaccatctcgcgaaacgcgagctgctg
ccgggctcgcgcggcatcgacatgcgccgccatccggcgggcgcgccgctcgtcgattcg
atcaagcgcggcttcgtctattcggacggctgggtcgacgatgcgcggctcgtcgtgctg
aacgcgctcgatgcgcaagagcgcggcgcgcgcatcctcacgcgcacgaagctcgtgtcg
gccgagcgccgcgacgggcaatggcatgcacgactgcaacgcgccgacggctcgacgctc
gacgtgcgggcgcgcgcgatcgcgaacgcggcgggcccgtgggtcggcgaagtgctgcac
ggcgcgctcggccgcggcgcgcagcatagcgtgcgcctcgtgaagggcagccatatcatc
acgccgcgcctgttcgatcacgaccacgcgtacatcttccagaatccggacaagcgcatc
atcttcgcgattccgtacgaacgcgacttcacgctgatcggcacgaccgacgtcgaatac
cgcgacgatccgtcgcgcgtcgcgatcgaccgcgacgaaacgcgctatctgtgcgagtcg
atcaaccgctatttcaagcgtaagatctcgcccgccgacgtatgctggacctactccggc
gtgcgcccgctgctcgaggacgagaacgcggacaacccgtccgccgtcacgcgcgactac
cgcctcgagctcgacgacggcgaaggcgcgccgctgctgtcggtgttcggcggcaagatc
acgacgtttcgcaagctcgccgaagaggcgaccgacatgctgggcggcgcgctcggcgcg
gcgcgcggcgcatggacggcgggggtgccgctgccgggcggcgacatcgcgaacgcgcgc
ttcgcgccgttcgccgaggcgttcgcgaaacgccacccgtggctgcccgccgcgctcgcg
cgccgctatgcgcgcgcgtacggcacgcgcgccgagcgcgtgatcgggcgagcccggtcg
cacgccgagctcggcgtgcagctcgcgcccggcctctacgaagcggaattgcgttatctg
cgcgacgtcgaatgggcgggttgcgcggacgacgtgctgtggcggcgttcgaagctcggc
ctgcatgtcgcgccgggcacgctcgagcccgtgacggccgcgctcgacgcctggttcggc
gccgcgcgcgaagcggcgagcgccgcgcactga

DBGET integrated database retrieval system