KEGG   Burkholderia mallei BMQ: DM76_4495Help
Entry
DM76_4495         CDS       T03490                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur family protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bmaq  Burkholderia mallei BMQ
Pathway
bmaq00020  Citrate cycle (TCA cycle)
bmaq00190  Oxidative phosphorylation
bmaq00650  Butanoate metabolism
bmaq01100  Metabolic pathways
bmaq01110  Biosynthesis of secondary metabolites
bmaq01120  Microbial metabolism in diverse environments
bmaq01130  Biosynthesis of antibiotics
bmaq01200  Carbon metabolism
Module
bmaq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmaq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bmaq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bmaq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DM76_4495
   00650 Butanoate metabolism
    DM76_4495
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DM76_4495
Enzymes [BR:bmaq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DM76_4495
    1.3.5.4  fumarate reductase (quinol)
     DM76_4495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4_4
Motif
Other DBs
NCBI-ProteinID: AIO61481
LinkDB All DBs
Position
2:1558970..1559677
Genome map
AA seq 235 aa AA seqDB search
MADTRILDIYRYDPDDGRAPRMQRYELAPRAEDRMLLDVLGRVKAQDETLSYRRSCREGV
CGSDAMNINGRNGLACVTSMQALPREIVLRPLPGLPVVRDLIVDMTSFFNQYHSVRPYLV
NEGVPPERERLQTPQEREQLDGLYECILCACCSSACPSYWWNPDKFVGPAGLLQAYRFIV
DSRDDASAARLDDLEDPYRLFRCRTIMNCVDVCPKGLNPARAIGQIRTMLARRAV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggccgatacccgcattctcgacatctaccgctacgatccggacgacgggcgcgcgccg
cgcatgcagcgctatgagctcgcgccgcgcgcggaagaccggatgctgctcgacgtgctc
ggccgcgtgaaggcgcaggacgagacgctgtcgtatcgccgctcgtgccgcgagggcgtg
tgcggctccgacgcgatgaacatcaacggccgcaacgggctcgcctgcgtgacgagcatg
caggcgctgccgcgcgaaatcgtgctgcggccgctgccggggctgcccgtcgtgcgcgat
ctgatcgtcgacatgacgagcttcttcaatcagtaccattcggtccgcccgtatctcgtc
aacgaaggcgtgccgcccgaacgagagcgcctgcagacgccgcaagagcgcgagcagctc
gacggcctctacgaatgcatcctgtgcgcgtgctgctcgagcgcgtgcccgagctactgg
tggaatcccgacaagttcgtcgggccggcggggctgctgcaggcgtaccgcttcatcgtc
gattcgcgcgacgacgcgagcgccgcgcgcctcgacgatctcgaggacccgtaccggctg
ttccgctgccggaccatcatgaactgtgtcgatgtctgtccgaaaggcctgaacccggcg
cgcgcgatcggacagatccgcacgatgctcgcgcggcgcgcggtatag

DBGET integrated database retrieval system