KEGG   Burkholderia mallei BMQ: DM76_4572
Entry
DM76_4572         CDS       T03490                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bmaq  Burkholderia mallei BMQ
Pathway
bmaq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmaq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    DM76_4572
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmaq02044]
    DM76_4572
Secretion system [BR:bmaq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   DM76_4572
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AIO61473
UniProt: A0A3N4FU58
LinkDB
Position
2:complement(1654285..1654770)
AA seq 161 aa
MAQDIFLKIDGINGESLDDSHKDEIEVLNWNWEIQQESTMHTGSGGGAGKASVKDLTFEH
AIDRASPNLMKYALTGKHVDQAVLVMRKAGGNPLEYLKLTMSDVIITRVRPSGSRDDTER
SRETVSLSFAKVKQEYVVQNAQGGSGGAVTTSFDIKGNKEA
NT seq 486 nt   +upstreamnt  +downstreamnt
atggcgcaggatatttttctgaagatcgacggcatcaacggtgaatccctcgacgacagc
cacaaggacgagatcgaagtcctgaactggaactgggagattcagcaggaatcgacgatg
cacacgggcagcggcggcggcgccggcaaggcgagcgtgaaggatctgacgttcgagcac
gcgatcgaccgcgcgagccccaacctgatgaagtacgcgctgaccggcaagcacgtcgat
caggcggtgctcgtgatgcgcaaggcgggcggcaatccgctcgaatacctgaagctcacg
atgagcgacgtgatcatcacgcgcgtgcggccgtcgggcagccgcgacgacaccgagcgc
agccgcgagacggtatcgctgtcgttcgcgaaggtgaagcaggagtatgtcgtgcagaac
gcgcagggcggcagcggcggcgccgtcacgacgagcttcgacatcaagggcaacaaggaa
gcctga

DBGET integrated database retrieval system