KEGG   Bermanella marisrubri: HF888_11440Help
Entry
HF888_11440       CDS       T06527                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bmar  Bermanella marisrubri
Brite
KEGG Orthology (KO) [BR:bmar00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HF888_11440 (ahpF)
Enzymes [BR:bmar01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HF888_11440 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 FAD_oxidored DAO Glutaredoxin FAD_binding_3 Thi4 NAD_binding_8 AlaDh_PNT_C Thioredoxin_9 K_oxygenase Lycopene_cycl DUF4404 Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: QIZ84795
LinkDB All DBs
Position
complement(2459301..2460911)
Genome map
AA seq 536 aa AA seqDB search
MLDDSMKQQLKAYLENLKTEVQLVLSLDESDTASKLKALANDIAALSDKVSVQEDDNASN
RKPMMQVVNPEKQSKLGFAGVPMGHEFTSLVLALLHSGGHPMKLEQEVIDQVAAIDKKLD
FEVFISLSCQNCPDVVQALNMMSVINPNITATMIDGSAFQEEVEAKNIMAVPSVFLNGEL
FSSGRMSLNDILKKVDTGASQREAKAISEKAPYDVLVIGGGPAGASAAIYAARKGIRTGL
VAERFGGQVMDTMAIENFISVKATEGPKLVHGLEEHVKDYDVDIMAEQKVDAVVPADETE
DGYIHVILENGARLKARSTIVTTGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKKTA
VIGGGNSGIEAAIDLAGIVEHVTVLEFADTLRADQVLIDKANSLPNVEIIKMAQTTEVEG
DGTRVTGLNYKDRESGEIKHVEVAGIFVQIGLVPNSEFLKTSGIELSDRGEIVIGDRGET
SKPGIFAAGDVTTVPYKQIIIAMGEGSRASLGAFDYLIRNPAPSKASSETELKESA
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgattcaatgaagcagcagttaaaagcgtacttagaaaacttgaaaaccgaa
gtacagctggttcttagccttgatgagagtgataccgcaagtaaattgaaagcattggct
aacgatattgcggctctcagcgacaaggtttcggtacaagaagacgataacgcatccaac
cgcaagccaatgatgcaagtcgttaaccctgaaaaacaaagcaagctaggttttgctggt
gtgccaatgggacatgagtttacgtctctggttttggcattgttgcatagcggcggacac
ccaatgaagcttgagcaagaggtgattgatcaggtagccgcgattgataaaaaactggac
ttcgaagtcttcatttcgttgtcttgtcaaaactgtcctgacgtcgtgcaagcattgaac
atgatgtcggtgataaacccaaatattacagccacgatgatcgacggttctgctttccaa
gaagaagtagaagcgaaaaacatcatggcggtgccaagtgtcttcttaaatggtgagtta
ttttcatccggccgtatgtctttaaatgacattctgaagaaggtagacacaggtgcgtca
cagcgtgaagcgaaagccatcagcgagaaagccccgtatgacgtacttgtcattggtggc
ggtcctgctggcgcgtccgcggccatttacgcagcacgtaaaggtattcgcactggtcta
gtcgccgaacgttttggcggccaagtgatggacaccatggccattgaaaacttcatttct
gtgaaagcaaccgaaggcccaaaattggtacacggtctagaagagcacgttaaagattac
gacgtggatatcatggccgaacaaaaagtggatgcggtggtacctgctgatgaaacagaa
gatggatatatccatgtgattttggaaaacggtgcgcgtttgaaagcacgcagtaccata
gtgaccacgggcgcacgctggagagagatgaatgtgccaggtgagcaagagtaccgcaac
aaaggcgtcgcttactgcccacactgtgatggtccattatttaaaggcaagaaaacagct
gtaatcggtggtggtaactctggtattgaagcggctatcgatttagcgggtatcgttgag
catgttactgtgttggaattcgccgataccttgcgtgcagaccaagttttgattgataaa
gccaatagcttgcctaacgttgagatcattaagatggctcaaaccactgaggtggaaggc
gatggtacgcgagttaccggtcttaactataaagaccgtgaaagcggtgaaatcaagcat
gtagaagtagcgggtatcttcgttcagattggtctggtgccaaacagcgagttcttgaaa
accagtggtattgaactgagcgaccgtggcgaaattgtcatcggtgaccgcggtgaaaca
tcgaaacccggtattttcgccgcaggtgatgtgaccacagtgccttataagcaaatcatt
attgctatgggtgaaggttcaagagccagcttaggtgcattcgattacttgatccgtaat
cctgcaccaagcaaagcaagttctgaaaccgagctgaaggaatcagcttaa

DBGET integrated database retrieval system