KEGG   Bermanella marisrubri: HF888_16290
Entry
HF888_16290       CDS       T06527                                 

Definition
(GenBank) replication protein A
Organism
bmar  Bermanella marisrubri
SSDB
Motif
Pfam: Replicase PriCT_1
Other DBs
NCBI-ProteinID: QIZ85899
LinkDB
Position
pBma45:4709..5911
AA seq 400 aa
MEALLQNYKNDSALSRIEEFLPYKPFCSDNKTAALIRVAYSALRYDYIQVNPPEMLAWMV
FDLDNHPTTGKEADPFIWQWEGLPPPNLIVTNLDNSKSHLYYAVAPVCRSKKARIKPQQY
FKAVRKKLGARLGADPDFTSPVSKNPFSKNFRTLEIHNDEYSLCELDVALDEPKANAFYE
LPGAATEVSIGRNTTVFNWLRYWAYEAVDEARKHDFDTWTRRCHVQARRFAIKASDALGK
ECLKDSEIKAIAKSVSGWVWNNYNGDNIDRGIMGLNDSGLDLKKKQSLAAHRTNSMSRER
NKKAVKRVILALKRAGFSNSEITRSRVAKIVGLGRKALYTTYKAVFDRYIAFPSKKASES
TRKLAGALFELRTPLDLTAISVIARKIHTSATWGLDPPPD
NT seq 1203 nt   +upstreamnt  +downstreamnt
atggaagcgctattgcagaattataaaaacgattcagctttatcaaggatcgaagaattt
ttaccttataaaccgttttgttcggataacaaaacggctgcgcttattcgcgttgcatat
agcgcgctgcgttatgactacatacaagtcaacccgcctgaaatgctcgcttggatggtg
ttcgatttagataatcatccaacaactgggaaagaagcagatccttttatttggcaatgg
gaagggttacctcccccaaatctaattgtcaccaacctcgataattccaaaagccatctt
tactatgctgttgcgccagtttgccgcagcaaaaaagcccgaattaaacctcagcaatat
tttaaagcagttcggaagaaacttggggctcgcttaggagccgatcctgatttcacatcg
ccggtgtccaaaaatccttttagcaaaaacttcagaacgttagaaatacataatgatgag
tactcgttgtgtgagttggatgttgccttagatgagcctaaagcgaatgcgttttatgag
cttcctggtgctgctacagaggtatccattggtcgtaacacgactgtttttaactggctg
agatactgggcttatgaagctgttgatgaagctagaaagcatgactttgatacatggaca
cgcaggtgtcatgtacaggctagacgttttgcaattaaagcctcggacgcacttgggaaa
gaatgtttgaaagacagcgagatcaaagcgattgcaaagtccgtctctggttgggtttgg
aacaattacaatggcgacaacatagatcgaggaatcatgggactaaatgattctgggctt
gatctcaagaaaaaacaatcacttgcagctcacagaactaattccatgagtcgtgagcgt
aataagaaagcagttaagcgagttattctggcactcaagagggctggattcagcaactct
gaaattacgagatccagagtcgcaaagattgttgggcttggccgtaaggcgctctatacg
acctacaaggctgtttttgatagatacattgcattcccttctaagaaagcctcagaaagc
actagaaagcttgctggagcgctattcgaattacgaacccccctagacctaaccgcgatt
tcagttatagcaagaaagatacatacatccgctacttggggcctagacccacctcctgat
tag

DBGET integrated database retrieval system