KEGG   Bermanella marisrubri: HF888_16295
Entry
HF888_16295       CDS       T06527                                 

Definition
(GenBank) type IV secretory system conjugative DNA transfer family protein
Organism
bmar  Bermanella marisrubri
SSDB
Motif
Pfam: TrwB_AAD_bind TraG-D_C AAA_10 CpXC PGA2
Other DBs
NCBI-ProteinID: QIZ85900
LinkDB
Position
pBma45:complement(6500..8515)
AA seq 671 aa
MSDLDRRYIEWIQSIASDMAELTNPYWFYVLTISLFLAALFSMSPLNTKADSKFSEHILV
KERKLIILTWFLLFCYPLLNMWLYAASNNDYSIEGITPFLTFYLELTKQQWPLPIMGLIS
GLLINFMYQRYMVSLISKFKRALRFKQSNDELSDIRNEKKRFKAKDFLPSKHYDKNGIVV
GLDENNKPLYIDNDTWYETNMQVVGPTRYGKGVILGGLIDQAIRRNDTVFYIDPKEDKFL
PYIMYNACKEMGRKFVYVSLKDGEIGSYSPFTGGNEFDARDRIITAFDLALTGHPGTDFY
KTQEQEEIDKYFSETKTIKGLASKINPDAASKLKAQLESWKRHESLCPKSGKGFSVEQAL
LDNAVVYIRGSLTSDILKKATKTLIIEVIQESMRLQKERQAHLSFFIDEVRFLASKQLAD
AMATAIGFRVNMVLAYQSILDTMTPDDQTLNGKSLTQSINVNSQVKAIYGGADTETAEWG
ASLSGERLKTITRLEKTEIKSGGGESWEPSRMLGSQAEHLIPANVFLSMPPRVCALYRPM
HQAQICFTSFVPVKETDSLDTYIASKQPKKQYDQVKDKSPRDLKDTNAPTENNQKEKEKD
SETKMNNLASVLPAPQKAEKGKRKQRRSKQKEKKQADRNIIGHEDLETGFEIDEQQITDF
MSESYVDELDN
NT seq 2016 nt   +upstreamnt  +downstreamnt
atgagcgatttagaccggcgctacatagaatggatacaatctattgcatcagatatggct
gaactgacaaatccatattggttctatgtgctcacgatttctctatttttagcagctctt
ttttcaatgtctccgttgaatacaaaagccgactcgaagttttcagaacacattttagtg
aaagaacgtaagctaataattcttacttggttcctattattttgctatccgctattaaat
atgtggctgtatgcagcatcaaataacgactattccatagaaggaataactccatttttg
accttttatttagagctgacaaaacaacaatggcccctcccaataatgggcttgatatcg
ggcttgcttatcaactttatgtaccaacggtacatggtatctttaatatcaaagttcaaa
agagcattgcgcttcaagcaatctaacgatgagctatctgatataagaaatgagaaaaag
cggttcaaagcaaaagactttcttccttcgaaacattacgacaaaaatggaatcgtcgta
ggtttagacgagaacaataaaccactctatatcgacaatgacacttggtatgagacaaat
atgcaagtggttgggcctactcgttacggtaagggtgtaattctcggcggtcttatagat
caagctattaggcgcaatgatactgtcttttatatagaccccaaggaagataaattcctt
ccgtatattatgtataacgcttgtaaagagatgggcagaaaatttgtctacgttagtctg
aaggatggcgaaataggtagttattctccatttaccggcggtaacgaattcgacgcaaga
gaccgaattattactgcatttgatttggcgctaacgggtcatccaggaacagatttctat
aaaactcaagaacaggaagaaatagataagtactttagtgaaaccaagacaataaaaggg
ctagcttcaaagataaacccagatgctgcttcaaagctgaaagcccagctcgaatcatgg
aaacgtcatgaatcattgtgcccaaaatcgggtaaaggtttttcggtcgaacaagctctt
ttggataatgctgtagtttatatacggggttctttgaccagtgatattctaaagaaagcc
actaaaacattaataattgaagttattcaggaatcgatgcgtctacaaaaagaacgccaa
gctcacctaagcttttttatcgacgaagttcgattcctagctagcaaacaattagctgat
gcgatggctaccgcaataggtttcagagtaaacatggtattagcctatcaatctattcta
gatacgatgactcctgacgaccaaacattaaatggaaagtcacttactcaaagtataaat
gtgaactctcaagttaaagctatttatgggggcgcagacactgaaacagcagagtggggg
gcttcgctctcaggtgaaagactcaaaacaataactcgcctagaaaaaacagaaataaaa
tcaggcggtggtgagtcatgggagccctctagaatgctgggttctcaagcagaacatttg
atacctgcaaatgtctttttatcaatgcctccgcgagtttgcgccctatatcgaccaatg
caccaggcacaaatttgttttactagttttgttccagtgaaagagacagattctctcgac
acatacattgcttcgaaacaaccaaaaaagcagtacgaccaagtaaaagacaagtcacca
cgcgaccttaaggacacgaacgctccaactgagaacaatcaaaaggaaaaagaaaaagac
tctgaaacaaaaatgaacaaccttgcttctgtattgcccgctccacaaaaagcggagaaa
gggaaacggaagcaacgaagatcaaaacaaaaagaaaagaaacaagctgatagaaatata
attggacacgaagatcttgaaactggatttgaaatcgatgagcaacaaatcactgacttt
atgtccgaatcctatgttgatgaactagacaactag

DBGET integrated database retrieval system